Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7MIY8

Protein Details
Accession A0A1C7MIY8    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
61-81GGGWGPRIRCRKNRYSYRGFVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 17, cyto_nucl 11.5, nucl 4, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012675  Beta-grasp_dom_sf  
IPR045001  DRG  
IPR031167  G_OBG  
IPR006073  GTP-bd  
IPR031662  GTP-binding_2  
IPR006074  GTP1-OBG_CS  
IPR027417  P-loop_NTPase  
IPR005225  Small_GTP-bd_dom  
IPR004095  TGS  
IPR012676  TGS-like  
Gene Ontology GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
Pfam View protein in Pfam  
PF01926  MMR_HSR1  
PF16897  MMR_HSR1_Xtn  
PF02824  TGS  
PROSITE View protein in PROSITE  
PS51710  G_OBG  
PS00905  GTP1_OBG  
PS51880  TGS  
CDD cd01896  DRG  
Amino Acid Sequences MTTVQKIKEIEDEMVSATDLGSDAVLSIAGQEYVLVRSTSRQLKAKLAKLRRELLGPTGGGGGWGPRIRCRKNRYSYRGFVGFPSVGKSTLMSKLTGTHSETSEIDFTTLTTVPGTLKVHGAPIQILDLPGIIEGANDGRGRGRQVIAVARTCNLIFIVLDVLKPLGDKKLIETELEGFGIRLNKKPPAILVRKKDKGGIAITNTVPLTNIDQDEIKAVLSEYKINNADIAIRQPNATADDLVDVIEGNRVYIPALYVLNKIDAISIEELDLLYKIPMSVPISSREWMNIDELIEKMWETLNLVRVYTKPRGLAPDYSSPVVLRRGKCTVEDFCSSIHKEIAKQMKYAIVWARVQSMREGRKSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.14
4 0.11
5 0.09
6 0.07
7 0.07
8 0.05
9 0.04
10 0.04
11 0.04
12 0.05
13 0.04
14 0.04
15 0.05
16 0.05
17 0.05
18 0.05
19 0.06
20 0.08
21 0.09
22 0.09
23 0.09
24 0.12
25 0.2
26 0.27
27 0.32
28 0.37
29 0.39
30 0.49
31 0.57
32 0.63
33 0.66
34 0.67
35 0.7
36 0.7
37 0.73
38 0.65
39 0.6
40 0.53
41 0.47
42 0.43
43 0.34
44 0.27
45 0.23
46 0.2
47 0.17
48 0.15
49 0.11
50 0.11
51 0.13
52 0.14
53 0.2
54 0.3
55 0.37
56 0.46
57 0.54
58 0.6
59 0.69
60 0.79
61 0.81
62 0.81
63 0.8
64 0.78
65 0.73
66 0.64
67 0.54
68 0.48
69 0.4
70 0.31
71 0.28
72 0.22
73 0.18
74 0.17
75 0.17
76 0.15
77 0.2
78 0.2
79 0.17
80 0.17
81 0.21
82 0.24
83 0.26
84 0.26
85 0.23
86 0.22
87 0.24
88 0.24
89 0.22
90 0.2
91 0.17
92 0.14
93 0.11
94 0.11
95 0.11
96 0.11
97 0.09
98 0.08
99 0.08
100 0.08
101 0.12
102 0.13
103 0.11
104 0.12
105 0.12
106 0.14
107 0.16
108 0.16
109 0.13
110 0.12
111 0.12
112 0.11
113 0.11
114 0.09
115 0.07
116 0.06
117 0.05
118 0.05
119 0.04
120 0.03
121 0.03
122 0.04
123 0.06
124 0.06
125 0.07
126 0.07
127 0.09
128 0.11
129 0.12
130 0.13
131 0.11
132 0.14
133 0.18
134 0.19
135 0.21
136 0.2
137 0.18
138 0.19
139 0.17
140 0.15
141 0.11
142 0.08
143 0.06
144 0.06
145 0.07
146 0.06
147 0.06
148 0.06
149 0.06
150 0.06
151 0.06
152 0.06
153 0.06
154 0.07
155 0.07
156 0.09
157 0.15
158 0.16
159 0.16
160 0.16
161 0.16
162 0.15
163 0.16
164 0.14
165 0.08
166 0.08
167 0.12
168 0.12
169 0.13
170 0.15
171 0.17
172 0.18
173 0.18
174 0.2
175 0.24
176 0.32
177 0.37
178 0.44
179 0.51
180 0.54
181 0.54
182 0.54
183 0.46
184 0.41
185 0.37
186 0.31
187 0.24
188 0.24
189 0.23
190 0.22
191 0.21
192 0.17
193 0.15
194 0.12
195 0.11
196 0.1
197 0.1
198 0.09
199 0.09
200 0.09
201 0.1
202 0.1
203 0.08
204 0.06
205 0.06
206 0.07
207 0.08
208 0.12
209 0.11
210 0.15
211 0.16
212 0.16
213 0.16
214 0.14
215 0.16
216 0.12
217 0.16
218 0.14
219 0.14
220 0.14
221 0.14
222 0.15
223 0.15
224 0.15
225 0.11
226 0.09
227 0.1
228 0.09
229 0.09
230 0.08
231 0.06
232 0.05
233 0.07
234 0.06
235 0.06
236 0.06
237 0.06
238 0.06
239 0.07
240 0.07
241 0.06
242 0.08
243 0.09
244 0.1
245 0.11
246 0.12
247 0.12
248 0.11
249 0.1
250 0.09
251 0.1
252 0.1
253 0.1
254 0.09
255 0.09
256 0.09
257 0.08
258 0.08
259 0.06
260 0.05
261 0.05
262 0.05
263 0.05
264 0.09
265 0.1
266 0.13
267 0.15
268 0.19
269 0.22
270 0.23
271 0.23
272 0.21
273 0.21
274 0.19
275 0.19
276 0.16
277 0.14
278 0.15
279 0.15
280 0.13
281 0.12
282 0.11
283 0.09
284 0.09
285 0.08
286 0.09
287 0.12
288 0.18
289 0.18
290 0.19
291 0.2
292 0.22
293 0.28
294 0.31
295 0.31
296 0.27
297 0.29
298 0.36
299 0.38
300 0.41
301 0.4
302 0.44
303 0.44
304 0.43
305 0.41
306 0.35
307 0.34
308 0.36
309 0.38
310 0.32
311 0.34
312 0.38
313 0.39
314 0.42
315 0.45
316 0.43
317 0.41
318 0.42
319 0.37
320 0.34
321 0.39
322 0.38
323 0.34
324 0.32
325 0.29
326 0.28
327 0.35
328 0.43
329 0.4
330 0.38
331 0.38
332 0.39
333 0.38
334 0.41
335 0.39
336 0.34
337 0.35
338 0.35
339 0.4
340 0.37
341 0.38
342 0.4
343 0.43
344 0.45