Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7M8K9

Protein Details
Accession A0A1C7M8K9    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
25-44TTTPRRRKSRLTRESNPPLIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 10.333, nucl 10, mito 9.5, cyto_nucl 7.833, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MRTACPSVMFLGLRIAVRPYIFSLTTTPRRRKSRLTRESNPPLIAYSRPMPPSIASDDDTCSDSLVSFRFYGLSPGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.13
4 0.13
5 0.14
6 0.13
7 0.14
8 0.14
9 0.15
10 0.17
11 0.22
12 0.32
13 0.39
14 0.45
15 0.51
16 0.58
17 0.6
18 0.68
19 0.72
20 0.73
21 0.75
22 0.77
23 0.75
24 0.78
25 0.81
26 0.74
27 0.63
28 0.52
29 0.43
30 0.35
31 0.28
32 0.22
33 0.17
34 0.18
35 0.18
36 0.18
37 0.18
38 0.18
39 0.2
40 0.21
41 0.21
42 0.19
43 0.19
44 0.2
45 0.21
46 0.21
47 0.18
48 0.15
49 0.12
50 0.1
51 0.11
52 0.11
53 0.12
54 0.1
55 0.11
56 0.12
57 0.12