Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7MI23

Protein Details
Accession A0A1C7MI23    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
108-132HENSLKTLKQRKKDIHFPIRKYAVKHydrophilic
NLS Segment(s)
PositionSequence
84-121KKKKYLPLDLRPKKTRAIRRRLTSHENSLKTLKQRKKD
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MLVPLDLNKMPGKVKAYELQSKSKNDLSKQLVELKTELLTLRVQKIAGGSAAKLTKINTVRKSIARVLTVMNQKARQNLREFYKKKKYLPLDLRPKKTRAIRRRLTSHENSLKTLKQRKKDIHFPIRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.37
4 0.43
5 0.46
6 0.5
7 0.52
8 0.54
9 0.54
10 0.53
11 0.52
12 0.45
13 0.5
14 0.47
15 0.46
16 0.45
17 0.49
18 0.45
19 0.41
20 0.39
21 0.32
22 0.26
23 0.22
24 0.19
25 0.12
26 0.13
27 0.14
28 0.15
29 0.15
30 0.14
31 0.14
32 0.14
33 0.13
34 0.12
35 0.11
36 0.09
37 0.11
38 0.12
39 0.11
40 0.12
41 0.11
42 0.16
43 0.21
44 0.28
45 0.28
46 0.32
47 0.34
48 0.35
49 0.39
50 0.37
51 0.34
52 0.28
53 0.25
54 0.22
55 0.25
56 0.27
57 0.26
58 0.24
59 0.24
60 0.25
61 0.3
62 0.32
63 0.3
64 0.3
65 0.33
66 0.37
67 0.45
68 0.46
69 0.5
70 0.58
71 0.59
72 0.59
73 0.63
74 0.62
75 0.62
76 0.69
77 0.7
78 0.71
79 0.74
80 0.79
81 0.75
82 0.72
83 0.69
84 0.68
85 0.69
86 0.68
87 0.7
88 0.7
89 0.74
90 0.8
91 0.8
92 0.8
93 0.75
94 0.75
95 0.74
96 0.67
97 0.61
98 0.58
99 0.55
100 0.55
101 0.59
102 0.56
103 0.56
104 0.63
105 0.7
106 0.74
107 0.8
108 0.82
109 0.83
110 0.85
111 0.81
112 0.82
113 0.81