Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7M5Z5

Protein Details
Accession A0A1C7M5Z5    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
25-44RTDTRRRSRGPSKRQQEKAPBasic
NLS Segment(s)
PositionSequence
30-38RRSRGPSKR
Subcellular Location(s) nucl 14.5, cyto_nucl 11.833, cyto 8, cyto_pero 6.333
Family & Domain DBs
Amino Acid Sequences MYEQAREMGDEDENGPPEYAHDLGRTDTRRRSRGPSKRQQEKAPEGRAPHEDDTAAGPVESERNGDAGGPAPNESRFTEGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.14
4 0.14
5 0.16
6 0.15
7 0.13
8 0.12
9 0.12
10 0.14
11 0.2
12 0.23
13 0.24
14 0.31
15 0.37
16 0.41
17 0.43
18 0.5
19 0.55
20 0.62
21 0.68
22 0.7
23 0.74
24 0.79
25 0.81
26 0.78
27 0.75
28 0.74
29 0.71
30 0.66
31 0.58
32 0.5
33 0.48
34 0.44
35 0.41
36 0.33
37 0.26
38 0.21
39 0.18
40 0.19
41 0.17
42 0.14
43 0.1
44 0.08
45 0.08
46 0.09
47 0.09
48 0.08
49 0.07
50 0.08
51 0.08
52 0.08
53 0.08
54 0.1
55 0.12
56 0.12
57 0.13
58 0.15
59 0.16
60 0.19
61 0.19