Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7MI46

Protein Details
Accession A0A1C7MI46   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
110-129KLVTRSSRRIQPRHHPRSRHBasic
258-277QAHPRRARPRVRRAEQVRCGBasic
NLS Segment(s)
PositionSequence
226-230PRPSP
262-268RRARPRV
Subcellular Location(s) cyto 9.5, cyto_nucl 8.5, nucl 6.5, mito 5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR042171  Acyl-CoA_hotdog  
Amino Acid Sequences MVFCIRDEGRKVEKEADEGEEQREEAFVSGDSIRSDALSKSYPVLSLDHVLVLHHGPALQALAVIADPSRSTSGKDSVSVYSAAIDPEWVILQAPQGGEEPRHTYPRYLKLVTRSSRRIQPRHHPRSRHSAPVRLEAPRPIHLTVHFLRIPRLATLHVHVRVLKIGRDFTNLLADLVQNVSLSCFALLMLRTHLTSPHLTGDSDDHDTHDVRRTRPAPLHTARPHPRPSPPKGPPHAHADAPLQVLLGPRHALLGHEQAHPRRARPRVRRAEQVRCGGHAVGHVLYAPDGAGPAAAVDDSVSCGLGDGARREHGRVRRGGPQMFPIPPASSPDHSPRTVALFSTGAFANDPQARHDTRVEVWTAPSDIGEGEERVGWREMQRCLAVMNTVMVVVPAAVNINAGAKGGKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.46
3 0.44
4 0.41
5 0.38
6 0.37
7 0.3
8 0.28
9 0.25
10 0.22
11 0.17
12 0.13
13 0.11
14 0.09
15 0.1
16 0.11
17 0.12
18 0.12
19 0.12
20 0.12
21 0.11
22 0.13
23 0.11
24 0.14
25 0.15
26 0.16
27 0.18
28 0.19
29 0.2
30 0.19
31 0.2
32 0.19
33 0.19
34 0.19
35 0.17
36 0.16
37 0.15
38 0.15
39 0.14
40 0.12
41 0.1
42 0.09
43 0.08
44 0.08
45 0.09
46 0.07
47 0.06
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.07
56 0.11
57 0.11
58 0.13
59 0.17
60 0.22
61 0.23
62 0.25
63 0.26
64 0.24
65 0.26
66 0.24
67 0.2
68 0.16
69 0.15
70 0.13
71 0.1
72 0.09
73 0.07
74 0.07
75 0.08
76 0.06
77 0.06
78 0.06
79 0.07
80 0.09
81 0.09
82 0.09
83 0.1
84 0.11
85 0.12
86 0.14
87 0.19
88 0.2
89 0.25
90 0.25
91 0.29
92 0.35
93 0.43
94 0.47
95 0.45
96 0.45
97 0.48
98 0.56
99 0.58
100 0.59
101 0.56
102 0.55
103 0.6
104 0.66
105 0.66
106 0.65
107 0.7
108 0.73
109 0.78
110 0.8
111 0.79
112 0.75
113 0.78
114 0.75
115 0.74
116 0.67
117 0.64
118 0.59
119 0.59
120 0.57
121 0.49
122 0.46
123 0.41
124 0.4
125 0.36
126 0.36
127 0.29
128 0.28
129 0.25
130 0.3
131 0.26
132 0.29
133 0.26
134 0.24
135 0.25
136 0.25
137 0.25
138 0.2
139 0.19
140 0.15
141 0.14
142 0.16
143 0.21
144 0.2
145 0.2
146 0.2
147 0.2
148 0.21
149 0.21
150 0.21
151 0.17
152 0.18
153 0.18
154 0.21
155 0.21
156 0.18
157 0.2
158 0.18
159 0.16
160 0.14
161 0.13
162 0.1
163 0.09
164 0.09
165 0.05
166 0.05
167 0.05
168 0.05
169 0.05
170 0.04
171 0.04
172 0.04
173 0.05
174 0.06
175 0.06
176 0.07
177 0.08
178 0.08
179 0.08
180 0.09
181 0.1
182 0.1
183 0.11
184 0.12
185 0.12
186 0.11
187 0.12
188 0.13
189 0.13
190 0.15
191 0.14
192 0.12
193 0.13
194 0.14
195 0.14
196 0.2
197 0.21
198 0.19
199 0.26
200 0.27
201 0.3
202 0.34
203 0.36
204 0.37
205 0.36
206 0.45
207 0.41
208 0.5
209 0.52
210 0.54
211 0.56
212 0.5
213 0.56
214 0.54
215 0.58
216 0.59
217 0.6
218 0.63
219 0.65
220 0.66
221 0.61
222 0.6
223 0.56
224 0.45
225 0.41
226 0.33
227 0.29
228 0.25
229 0.22
230 0.14
231 0.12
232 0.14
233 0.12
234 0.11
235 0.09
236 0.08
237 0.08
238 0.08
239 0.08
240 0.09
241 0.15
242 0.17
243 0.2
244 0.23
245 0.24
246 0.31
247 0.32
248 0.33
249 0.35
250 0.41
251 0.47
252 0.55
253 0.64
254 0.68
255 0.72
256 0.79
257 0.79
258 0.81
259 0.78
260 0.76
261 0.66
262 0.57
263 0.53
264 0.43
265 0.36
266 0.26
267 0.21
268 0.13
269 0.11
270 0.1
271 0.08
272 0.08
273 0.07
274 0.06
275 0.04
276 0.04
277 0.04
278 0.03
279 0.03
280 0.03
281 0.03
282 0.03
283 0.03
284 0.03
285 0.03
286 0.04
287 0.05
288 0.05
289 0.04
290 0.05
291 0.05
292 0.07
293 0.09
294 0.1
295 0.12
296 0.16
297 0.17
298 0.19
299 0.27
300 0.32
301 0.37
302 0.41
303 0.43
304 0.48
305 0.54
306 0.56
307 0.5
308 0.5
309 0.49
310 0.44
311 0.42
312 0.35
313 0.3
314 0.27
315 0.29
316 0.27
317 0.24
318 0.27
319 0.33
320 0.36
321 0.35
322 0.35
323 0.32
324 0.33
325 0.31
326 0.27
327 0.22
328 0.18
329 0.17
330 0.19
331 0.18
332 0.13
333 0.13
334 0.13
335 0.16
336 0.19
337 0.19
338 0.19
339 0.25
340 0.26
341 0.29
342 0.32
343 0.29
344 0.29
345 0.32
346 0.31
347 0.27
348 0.26
349 0.26
350 0.24
351 0.21
352 0.18
353 0.14
354 0.12
355 0.13
356 0.13
357 0.11
358 0.1
359 0.13
360 0.13
361 0.16
362 0.17
363 0.17
364 0.2
365 0.26
366 0.28
367 0.31
368 0.32
369 0.3
370 0.29
371 0.29
372 0.25
373 0.2
374 0.18
375 0.13
376 0.11
377 0.11
378 0.1
379 0.08
380 0.07
381 0.06
382 0.05
383 0.06
384 0.06
385 0.06
386 0.06
387 0.08
388 0.08
389 0.09