Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7MD19

Protein Details
Accession A0A1C7MD19    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
122-155TPSSLDKRLQARQRRTQKRYPRNQCSKNPRSMSLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito 4, cyto_pero 2, cyto 1.5, pero 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004821  Cyt_trans-like  
IPR045049  Pcy1-like  
IPR014729  Rossmann-like_a/b/a_fold  
Gene Ontology GO:0004105  F:choline-phosphate cytidylyltransferase activity  
Pfam View protein in Pfam  
PF01467  CTP_transf_like  
Amino Acid Sequences MVGVFADDLCERYNSPTPMRHVDRCEVVRHCRWVDEVVADAPWAMEEKFLRAKQIDYVAIDEGSSIDPACDRERLKGYDLVKSLPGKAIPTRRTNISTPMERIVDPYPSPESARGTIKGVPTPSSLDKRLQARQRRTQKRYPRNQCSKNPRSMSLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.3
3 0.35
4 0.39
5 0.48
6 0.53
7 0.54
8 0.52
9 0.53
10 0.56
11 0.53
12 0.54
13 0.5
14 0.5
15 0.51
16 0.52
17 0.48
18 0.41
19 0.41
20 0.36
21 0.32
22 0.26
23 0.22
24 0.16
25 0.15
26 0.13
27 0.11
28 0.09
29 0.07
30 0.07
31 0.05
32 0.07
33 0.07
34 0.1
35 0.17
36 0.18
37 0.2
38 0.2
39 0.21
40 0.22
41 0.25
42 0.23
43 0.18
44 0.19
45 0.17
46 0.16
47 0.15
48 0.12
49 0.09
50 0.07
51 0.07
52 0.05
53 0.04
54 0.05
55 0.07
56 0.08
57 0.11
58 0.11
59 0.15
60 0.19
61 0.2
62 0.22
63 0.26
64 0.25
65 0.26
66 0.27
67 0.24
68 0.23
69 0.22
70 0.2
71 0.17
72 0.16
73 0.13
74 0.17
75 0.24
76 0.26
77 0.3
78 0.32
79 0.34
80 0.37
81 0.37
82 0.4
83 0.37
84 0.36
85 0.33
86 0.34
87 0.32
88 0.28
89 0.3
90 0.24
91 0.21
92 0.18
93 0.18
94 0.18
95 0.18
96 0.19
97 0.18
98 0.2
99 0.21
100 0.24
101 0.22
102 0.22
103 0.24
104 0.25
105 0.27
106 0.25
107 0.24
108 0.22
109 0.25
110 0.29
111 0.31
112 0.31
113 0.32
114 0.36
115 0.4
116 0.47
117 0.52
118 0.56
119 0.61
120 0.69
121 0.76
122 0.81
123 0.83
124 0.85
125 0.87
126 0.88
127 0.9
128 0.91
129 0.91
130 0.91
131 0.93
132 0.93
133 0.93
134 0.91
135 0.9
136 0.84