Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7LLY7

Protein Details
Accession A0A1C7LLY7    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
147-172FTPDGRLQRKDVRKRRLRSVWTLGARHydrophilic
NLS Segment(s)
PositionSequence
156-164KDVRKRRLR
Subcellular Location(s) mito 8, cyto 7, mito_nucl 7, nucl 6
Family & Domain DBs
Amino Acid Sequences MRGKHMEDNYEKIRLMVDAVDLTHGDMRVTMLMEPDIGSRAVCAWGEDCSAPGETINSSVSRWTGRTDERREKDWWLSRGGSWDLFTEIARIIQFGESGAAEVVLPKSLLFRARPSERGKAWERTGWQAWRSRVRDVTAADGGAQYFTPDGRLQRKDVRKRRLRSVWTLGARKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.22
3 0.16
4 0.13
5 0.1
6 0.1
7 0.11
8 0.1
9 0.11
10 0.12
11 0.11
12 0.1
13 0.09
14 0.1
15 0.09
16 0.1
17 0.09
18 0.08
19 0.08
20 0.09
21 0.09
22 0.09
23 0.09
24 0.08
25 0.08
26 0.07
27 0.07
28 0.09
29 0.08
30 0.08
31 0.08
32 0.08
33 0.1
34 0.1
35 0.1
36 0.1
37 0.1
38 0.1
39 0.09
40 0.09
41 0.07
42 0.09
43 0.09
44 0.08
45 0.08
46 0.09
47 0.1
48 0.1
49 0.11
50 0.12
51 0.14
52 0.21
53 0.29
54 0.37
55 0.46
56 0.48
57 0.51
58 0.51
59 0.51
60 0.53
61 0.51
62 0.45
63 0.38
64 0.36
65 0.32
66 0.34
67 0.31
68 0.24
69 0.17
70 0.15
71 0.12
72 0.12
73 0.11
74 0.08
75 0.07
76 0.07
77 0.06
78 0.06
79 0.06
80 0.05
81 0.05
82 0.05
83 0.05
84 0.04
85 0.05
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.05
95 0.06
96 0.09
97 0.1
98 0.14
99 0.21
100 0.24
101 0.31
102 0.35
103 0.41
104 0.4
105 0.45
106 0.47
107 0.46
108 0.45
109 0.43
110 0.41
111 0.4
112 0.44
113 0.42
114 0.41
115 0.41
116 0.44
117 0.5
118 0.5
119 0.49
120 0.47
121 0.45
122 0.46
123 0.41
124 0.4
125 0.32
126 0.29
127 0.24
128 0.21
129 0.18
130 0.14
131 0.12
132 0.07
133 0.06
134 0.06
135 0.08
136 0.1
137 0.17
138 0.24
139 0.28
140 0.33
141 0.43
142 0.53
143 0.62
144 0.7
145 0.75
146 0.77
147 0.81
148 0.86
149 0.87
150 0.84
151 0.82
152 0.81
153 0.8
154 0.79