Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7M0J1

Protein Details
Accession A0A1C7M0J1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
49-71YGLGRCCIRRRPRDRDWQNKDGPHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, plas 9, E.R. 3, mito 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIAFIFDLVLFFLTKSRINSVSGGSATMGIGIWLTLAAWICLFFAGCFYGLGRCCIRRRPRDRDWQNKDGPGAENGFAEQMRLDAVKAEADRKARQKQGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.19
4 0.2
5 0.21
6 0.23
7 0.23
8 0.24
9 0.21
10 0.2
11 0.16
12 0.14
13 0.12
14 0.11
15 0.08
16 0.05
17 0.04
18 0.03
19 0.03
20 0.02
21 0.03
22 0.03
23 0.03
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.03
31 0.04
32 0.04
33 0.05
34 0.05
35 0.05
36 0.08
37 0.08
38 0.11
39 0.11
40 0.15
41 0.17
42 0.25
43 0.34
44 0.42
45 0.51
46 0.57
47 0.65
48 0.72
49 0.81
50 0.83
51 0.83
52 0.81
53 0.77
54 0.71
55 0.64
56 0.55
57 0.46
58 0.37
59 0.3
60 0.22
61 0.18
62 0.15
63 0.15
64 0.12
65 0.11
66 0.09
67 0.06
68 0.07
69 0.07
70 0.07
71 0.07
72 0.08
73 0.12
74 0.13
75 0.16
76 0.19
77 0.24
78 0.31
79 0.38
80 0.47