Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7LT34

Protein Details
Accession A0A1C7LT34    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGGTACTCKRRRLRQVGRTLTLTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25.5, cyto_mito 13.5
Family & Domain DBs
Amino Acid Sequences MGGTACTCKRRRLRQVGRTLTLTPTLIDWPGQAPQGWGAMHTSGRIWSLSAEEKLGRSAGAEQANGGGVACDAIRVLPVRTGGEYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.9
3 0.89
4 0.83
5 0.76
6 0.66
7 0.57
8 0.48
9 0.38
10 0.27
11 0.19
12 0.16
13 0.13
14 0.12
15 0.1
16 0.09
17 0.1
18 0.1
19 0.09
20 0.09
21 0.09
22 0.11
23 0.1
24 0.09
25 0.09
26 0.09
27 0.09
28 0.09
29 0.08
30 0.06
31 0.07
32 0.07
33 0.06
34 0.06
35 0.08
36 0.1
37 0.1
38 0.11
39 0.11
40 0.11
41 0.12
42 0.12
43 0.09
44 0.08
45 0.09
46 0.13
47 0.14
48 0.14
49 0.13
50 0.13
51 0.14
52 0.13
53 0.11
54 0.06
55 0.04
56 0.05
57 0.04
58 0.04
59 0.04
60 0.04
61 0.06
62 0.07
63 0.08
64 0.1
65 0.13
66 0.15