Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7MPE4

Protein Details
Accession A0A1C7MPE4    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAPAERTKRQKSMKRLGENLRGLHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, nucl 6, mito 5.5, cyto_mito 4.5, cyto 2.5, E.R. 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR003445  Cat_transpt  
Gene Ontology GO:0016020  C:membrane  
GO:0008324  F:monoatomic cation transmembrane transporter activity  
GO:0030001  P:metal ion transport  
Pfam View protein in Pfam  
PF02386  TrkH  
Amino Acid Sequences MAPAERTKRQKSMKRLGENLRGLVIGRNSDFNTEYLSDEQLEELGGLEYRALRLLSYLVILYFIGTQMITFILIAPWLSTSSEYDDVFASQPRLVNKSWFVAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.83
3 0.82
4 0.81
5 0.75
6 0.66
7 0.56
8 0.46
9 0.37
10 0.32
11 0.25
12 0.17
13 0.15
14 0.16
15 0.16
16 0.18
17 0.18
18 0.15
19 0.16
20 0.15
21 0.16
22 0.14
23 0.15
24 0.13
25 0.12
26 0.12
27 0.09
28 0.08
29 0.06
30 0.05
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.05
38 0.04
39 0.04
40 0.04
41 0.05
42 0.05
43 0.05
44 0.05
45 0.04
46 0.05
47 0.05
48 0.05
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.05
64 0.05
65 0.06
66 0.07
67 0.08
68 0.13
69 0.16
70 0.16
71 0.16
72 0.16
73 0.17
74 0.17
75 0.18
76 0.15
77 0.14
78 0.17
79 0.19
80 0.22
81 0.22
82 0.26
83 0.27