Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7M4C6

Protein Details
Accession A0A1C7M4C6   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
453-477ASQNAQHKRTRKPSCPVRAHPRSFHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023210  NADP_OxRdtase_dom  
IPR036812  NADP_OxRdtase_dom_sf  
Pfam View protein in Pfam  
PF00248  Aldo_ket_red  
Amino Acid Sequences MWLFADLHRPSPENLRRSVDKILAALRGTKKVDLFEPARIDSNVSVEDTVRTLAELVREGKFDHIGLSETRAETLRRGNAIHPISMVEIEVSPWSYEEETKKVIATASELGITVAAYSPLGRGFLTGSIKKSEDLAETDIRRNLTRFQNENIRHNTAIVDALTALAAQKGITPAQLCIAWVGALGATMLPLPGSSNAKRTLENLAGGSVVLTQADMDAVARVLAAHPTRVFTPHGVPDDLTATQPSSKPQVPYLSHSHPQNPPHVLHDGVHDRAIHPSHHPRTEESQGLDDRSTIHQLSSRLAQTRSHGAHESLERHAPLGGHLPERAAHSKPALRAPSEPIMFRIARARQMAKYEQRTLLATCTRPKAHSTNEHRRPAAQSACVHPPSFRPRSHGAHESLERHASLGGHLLARAAPSKQAIASNPALRRSRSCFASPRARQMARYEPHNMHASQNAQHKRTRKPSCPVRAHPRSFHPRAATQTTCRSCFVFRTSERALWPDIKNYLRTATPPGRPRPRSAAAVQSCSRPERAASPKTVSILTTIPSPRPGQLAEEEAHIGAPKHPSHTQGVELTPNST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.5
3 0.51
4 0.54
5 0.58
6 0.51
7 0.45
8 0.43
9 0.41
10 0.37
11 0.34
12 0.37
13 0.35
14 0.37
15 0.37
16 0.37
17 0.36
18 0.35
19 0.36
20 0.37
21 0.35
22 0.36
23 0.38
24 0.37
25 0.38
26 0.36
27 0.35
28 0.28
29 0.28
30 0.23
31 0.2
32 0.18
33 0.15
34 0.16
35 0.15
36 0.15
37 0.12
38 0.1
39 0.1
40 0.11
41 0.12
42 0.15
43 0.17
44 0.18
45 0.19
46 0.2
47 0.21
48 0.22
49 0.2
50 0.17
51 0.15
52 0.15
53 0.16
54 0.19
55 0.2
56 0.18
57 0.2
58 0.2
59 0.2
60 0.21
61 0.27
62 0.28
63 0.27
64 0.29
65 0.29
66 0.36
67 0.37
68 0.35
69 0.28
70 0.24
71 0.23
72 0.21
73 0.19
74 0.11
75 0.09
76 0.09
77 0.09
78 0.09
79 0.08
80 0.08
81 0.1
82 0.1
83 0.15
84 0.18
85 0.21
86 0.22
87 0.23
88 0.23
89 0.22
90 0.21
91 0.17
92 0.17
93 0.16
94 0.14
95 0.14
96 0.13
97 0.12
98 0.11
99 0.11
100 0.08
101 0.06
102 0.05
103 0.05
104 0.05
105 0.06
106 0.06
107 0.07
108 0.06
109 0.07
110 0.08
111 0.12
112 0.18
113 0.2
114 0.22
115 0.25
116 0.26
117 0.25
118 0.26
119 0.23
120 0.2
121 0.2
122 0.22
123 0.25
124 0.27
125 0.3
126 0.31
127 0.31
128 0.3
129 0.28
130 0.31
131 0.34
132 0.39
133 0.39
134 0.41
135 0.5
136 0.53
137 0.59
138 0.58
139 0.54
140 0.46
141 0.43
142 0.39
143 0.29
144 0.26
145 0.18
146 0.12
147 0.08
148 0.08
149 0.07
150 0.06
151 0.06
152 0.04
153 0.04
154 0.04
155 0.05
156 0.06
157 0.07
158 0.08
159 0.09
160 0.09
161 0.11
162 0.11
163 0.1
164 0.09
165 0.09
166 0.07
167 0.06
168 0.06
169 0.04
170 0.04
171 0.04
172 0.03
173 0.03
174 0.03
175 0.03
176 0.03
177 0.03
178 0.04
179 0.06
180 0.11
181 0.12
182 0.17
183 0.21
184 0.22
185 0.23
186 0.24
187 0.27
188 0.24
189 0.24
190 0.2
191 0.17
192 0.15
193 0.14
194 0.13
195 0.08
196 0.06
197 0.04
198 0.03
199 0.03
200 0.03
201 0.03
202 0.03
203 0.03
204 0.03
205 0.03
206 0.03
207 0.03
208 0.03
209 0.04
210 0.07
211 0.07
212 0.09
213 0.09
214 0.1
215 0.11
216 0.13
217 0.14
218 0.13
219 0.16
220 0.18
221 0.2
222 0.2
223 0.19
224 0.18
225 0.19
226 0.18
227 0.15
228 0.11
229 0.09
230 0.1
231 0.11
232 0.12
233 0.14
234 0.16
235 0.17
236 0.19
237 0.26
238 0.26
239 0.3
240 0.35
241 0.36
242 0.37
243 0.38
244 0.4
245 0.38
246 0.39
247 0.39
248 0.35
249 0.31
250 0.3
251 0.3
252 0.25
253 0.21
254 0.23
255 0.21
256 0.18
257 0.19
258 0.16
259 0.15
260 0.17
261 0.18
262 0.14
263 0.15
264 0.24
265 0.27
266 0.3
267 0.31
268 0.31
269 0.35
270 0.37
271 0.36
272 0.28
273 0.27
274 0.24
275 0.24
276 0.21
277 0.17
278 0.15
279 0.13
280 0.14
281 0.11
282 0.1
283 0.12
284 0.13
285 0.14
286 0.16
287 0.17
288 0.17
289 0.18
290 0.19
291 0.18
292 0.24
293 0.24
294 0.23
295 0.22
296 0.2
297 0.22
298 0.23
299 0.24
300 0.19
301 0.19
302 0.17
303 0.16
304 0.16
305 0.13
306 0.11
307 0.15
308 0.14
309 0.14
310 0.14
311 0.14
312 0.14
313 0.18
314 0.2
315 0.15
316 0.15
317 0.17
318 0.2
319 0.22
320 0.26
321 0.25
322 0.24
323 0.24
324 0.28
325 0.31
326 0.29
327 0.27
328 0.23
329 0.25
330 0.23
331 0.22
332 0.24
333 0.2
334 0.23
335 0.26
336 0.28
337 0.25
338 0.3
339 0.36
340 0.38
341 0.42
342 0.42
343 0.4
344 0.38
345 0.38
346 0.34
347 0.31
348 0.28
349 0.25
350 0.24
351 0.28
352 0.28
353 0.28
354 0.32
355 0.32
356 0.35
357 0.43
358 0.49
359 0.55
360 0.63
361 0.67
362 0.64
363 0.61
364 0.58
365 0.54
366 0.48
367 0.42
368 0.35
369 0.33
370 0.39
371 0.39
372 0.35
373 0.29
374 0.32
375 0.36
376 0.4
377 0.37
378 0.36
379 0.41
380 0.46
381 0.51
382 0.51
383 0.45
384 0.45
385 0.48
386 0.45
387 0.41
388 0.37
389 0.31
390 0.25
391 0.22
392 0.16
393 0.12
394 0.12
395 0.11
396 0.1
397 0.1
398 0.1
399 0.09
400 0.1
401 0.11
402 0.09
403 0.09
404 0.1
405 0.11
406 0.12
407 0.14
408 0.15
409 0.19
410 0.23
411 0.28
412 0.29
413 0.35
414 0.37
415 0.36
416 0.39
417 0.41
418 0.42
419 0.4
420 0.42
421 0.43
422 0.48
423 0.57
424 0.56
425 0.59
426 0.62
427 0.59
428 0.57
429 0.55
430 0.58
431 0.5
432 0.51
433 0.49
434 0.41
435 0.45
436 0.46
437 0.41
438 0.33
439 0.34
440 0.33
441 0.31
442 0.39
443 0.41
444 0.4
445 0.44
446 0.49
447 0.54
448 0.62
449 0.66
450 0.65
451 0.69
452 0.76
453 0.82
454 0.85
455 0.85
456 0.86
457 0.87
458 0.84
459 0.8
460 0.79
461 0.79
462 0.74
463 0.7
464 0.65
465 0.59
466 0.6
467 0.61
468 0.56
469 0.51
470 0.57
471 0.55
472 0.53
473 0.49
474 0.44
475 0.39
476 0.39
477 0.38
478 0.37
479 0.33
480 0.38
481 0.41
482 0.43
483 0.43
484 0.41
485 0.4
486 0.38
487 0.38
488 0.36
489 0.38
490 0.38
491 0.38
492 0.37
493 0.36
494 0.31
495 0.31
496 0.35
497 0.36
498 0.41
499 0.48
500 0.56
501 0.64
502 0.66
503 0.7
504 0.7
505 0.68
506 0.66
507 0.61
508 0.62
509 0.56
510 0.6
511 0.55
512 0.52
513 0.49
514 0.46
515 0.44
516 0.35
517 0.31
518 0.33
519 0.4
520 0.42
521 0.44
522 0.47
523 0.48
524 0.49
525 0.48
526 0.39
527 0.33
528 0.28
529 0.23
530 0.24
531 0.24
532 0.24
533 0.28
534 0.29
535 0.28
536 0.3
537 0.3
538 0.27
539 0.28
540 0.3
541 0.27
542 0.27
543 0.26
544 0.23
545 0.22
546 0.19
547 0.17
548 0.16
549 0.21
550 0.21
551 0.25
552 0.27
553 0.31
554 0.36
555 0.38
556 0.4
557 0.38
558 0.39
559 0.4