Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7LMH9

Protein Details
Accession A0A1C7LMH9    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
75-100MFKDVVIKECKKKRQRETHNEPDEELHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 6, mito 4, plas 1, pero 1, golg 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MPSRIATSWEDSTSSSGLPGSIGGGARFTRWRNTSGFCPSPALANSPNFLSCLFDDFDAQSSCAFGQRSTCQRVMFKDVVIKECKKKRQRETHNEPDEELVDVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.15
3 0.12
4 0.1
5 0.09
6 0.08
7 0.06
8 0.07
9 0.07
10 0.07
11 0.09
12 0.09
13 0.11
14 0.15
15 0.16
16 0.21
17 0.22
18 0.25
19 0.26
20 0.3
21 0.33
22 0.37
23 0.38
24 0.32
25 0.33
26 0.3
27 0.29
28 0.26
29 0.24
30 0.19
31 0.18
32 0.18
33 0.15
34 0.16
35 0.13
36 0.13
37 0.11
38 0.08
39 0.1
40 0.09
41 0.09
42 0.09
43 0.09
44 0.12
45 0.1
46 0.11
47 0.08
48 0.08
49 0.08
50 0.1
51 0.1
52 0.08
53 0.12
54 0.17
55 0.23
56 0.28
57 0.3
58 0.3
59 0.33
60 0.36
61 0.39
62 0.35
63 0.31
64 0.32
65 0.32
66 0.34
67 0.37
68 0.39
69 0.41
70 0.49
71 0.58
72 0.61
73 0.69
74 0.75
75 0.8
76 0.87
77 0.88
78 0.9
79 0.91
80 0.91
81 0.82
82 0.73
83 0.65
84 0.54