Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7ZBB3

Protein Details
Accession C7ZBB3    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
88-120TKTEVEKKPVKKAKKKKRAEVKSKEKSVRKSYNBasic
NLS Segment(s)
PositionSequence
93-117EKKPVKKAKKKKRAEVKSKEKSVRK
Subcellular Location(s) nucl 15.5, mito_nucl 12.166, cyto_nucl 10.833, mito 7.5
Family & Domain DBs
KEGG nhe:NECHADRAFT_83086  -  
Amino Acid Sequences MKPSLPTIIHFRQDSILNKGTLKEALSEIFGSTYWTLTEGPHTFYVEAANEPNVDVVSALEAAGAIQMRSVDEPSAIMDEDRTESKETKTEVEKKPVKKAKKKKRAEVKSKEKSVRKSYNVADEKSTDEPVRAICNVNKPRKPTEGVGRAMAMPPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.4
3 0.38
4 0.34
5 0.34
6 0.34
7 0.32
8 0.28
9 0.24
10 0.19
11 0.16
12 0.15
13 0.16
14 0.15
15 0.13
16 0.12
17 0.11
18 0.11
19 0.1
20 0.1
21 0.08
22 0.09
23 0.09
24 0.09
25 0.15
26 0.14
27 0.17
28 0.18
29 0.19
30 0.18
31 0.17
32 0.19
33 0.14
34 0.13
35 0.11
36 0.1
37 0.09
38 0.09
39 0.09
40 0.08
41 0.06
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.03
49 0.03
50 0.04
51 0.04
52 0.03
53 0.03
54 0.03
55 0.04
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.06
63 0.06
64 0.05
65 0.05
66 0.05
67 0.06
68 0.07
69 0.08
70 0.09
71 0.1
72 0.11
73 0.15
74 0.15
75 0.17
76 0.23
77 0.31
78 0.33
79 0.42
80 0.48
81 0.48
82 0.58
83 0.63
84 0.66
85 0.68
86 0.75
87 0.76
88 0.8
89 0.86
90 0.86
91 0.89
92 0.9
93 0.91
94 0.91
95 0.91
96 0.9
97 0.89
98 0.88
99 0.84
100 0.81
101 0.8
102 0.79
103 0.72
104 0.69
105 0.63
106 0.65
107 0.64
108 0.57
109 0.49
110 0.41
111 0.41
112 0.37
113 0.36
114 0.26
115 0.21
116 0.2
117 0.19
118 0.22
119 0.19
120 0.21
121 0.21
122 0.31
123 0.41
124 0.5
125 0.53
126 0.55
127 0.6
128 0.62
129 0.64
130 0.61
131 0.62
132 0.6
133 0.58
134 0.55
135 0.51
136 0.46