Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7LKU4

Protein Details
Accession A0A1C7LKU4   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-35VLARCLFPRTRSERPRRARRAVLRLPRSHGAHydrophilic
43-64LACHRSPRTRCGHPRGARHAAIHydrophilic
154-174LFPHTCCRRSRRARHAAIRSGHydrophilic
295-315AGHRSPRTRCGHPRRARHAAIBasic
367-388HLFPRTRSERPWRARRAALRLPHydrophilic
NLS Segment(s)
PositionSequence
16-27SERPRRARRAVL
Subcellular Location(s) mito 14, extr 5, nucl 4, cyto 2, plas 2
Family & Domain DBs
Amino Acid Sequences MPLFVLARCLFPRTRSERPRRARRAVLRLPRSHGAACRPPLPLACHRSPRTRCGHPRGARHAAIHPGAPSISSYALRTSTVNLPCRYSFWRAVYFLVRAPNVHGEPIVPRFVFLARMAPPAALPYLWHAADLRVRAADIRGESAMLLFVLAHHLFPHTCCRRSRRARHAAIRSGALSISSYVLRTSTASLSCRASSSLLAWRRPPPSPTSGAPPMSACMLRISVVSLPCRYSHWHAADLRVRAADIHGEPAMPLFVFPARMAPPAALPYLWHAADVRVHAADIRGESAMPLFALAGHRSPRTRCGHPRRARHAAIHFGTPSISSYTLRTFTASPPCCYSFWHAADLRVRAADICGEPAVPLFILAHHLFPRTRSERPWRARRAALRLPHSHGAAATLPYLWHDADLRVHTADICGMSAMPLFALAGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.57
3 0.67
4 0.73
5 0.82
6 0.9
7 0.9
8 0.91
9 0.91
10 0.9
11 0.9
12 0.89
13 0.89
14 0.88
15 0.83
16 0.81
17 0.74
18 0.68
19 0.61
20 0.56
21 0.53
22 0.52
23 0.5
24 0.48
25 0.46
26 0.44
27 0.44
28 0.46
29 0.46
30 0.46
31 0.5
32 0.55
33 0.58
34 0.66
35 0.67
36 0.7
37 0.69
38 0.71
39 0.73
40 0.73
41 0.79
42 0.76
43 0.81
44 0.81
45 0.81
46 0.74
47 0.67
48 0.62
49 0.58
50 0.52
51 0.43
52 0.35
53 0.28
54 0.24
55 0.21
56 0.17
57 0.12
58 0.13
59 0.12
60 0.13
61 0.13
62 0.15
63 0.15
64 0.15
65 0.17
66 0.23
67 0.29
68 0.35
69 0.34
70 0.37
71 0.37
72 0.4
73 0.41
74 0.39
75 0.39
76 0.36
77 0.4
78 0.38
79 0.4
80 0.4
81 0.37
82 0.33
83 0.32
84 0.28
85 0.23
86 0.24
87 0.27
88 0.24
89 0.23
90 0.21
91 0.16
92 0.19
93 0.22
94 0.23
95 0.17
96 0.16
97 0.16
98 0.17
99 0.18
100 0.15
101 0.17
102 0.15
103 0.17
104 0.17
105 0.16
106 0.16
107 0.15
108 0.15
109 0.1
110 0.08
111 0.1
112 0.13
113 0.13
114 0.13
115 0.13
116 0.14
117 0.17
118 0.18
119 0.15
120 0.12
121 0.12
122 0.12
123 0.12
124 0.13
125 0.11
126 0.12
127 0.11
128 0.11
129 0.1
130 0.1
131 0.09
132 0.06
133 0.05
134 0.03
135 0.03
136 0.07
137 0.07
138 0.07
139 0.07
140 0.08
141 0.08
142 0.1
143 0.2
144 0.22
145 0.27
146 0.32
147 0.38
148 0.48
149 0.58
150 0.67
151 0.68
152 0.73
153 0.78
154 0.82
155 0.84
156 0.8
157 0.71
158 0.62
159 0.52
160 0.42
161 0.32
162 0.23
163 0.15
164 0.09
165 0.08
166 0.07
167 0.06
168 0.06
169 0.06
170 0.07
171 0.07
172 0.08
173 0.09
174 0.11
175 0.12
176 0.14
177 0.15
178 0.15
179 0.15
180 0.14
181 0.13
182 0.11
183 0.12
184 0.18
185 0.2
186 0.22
187 0.24
188 0.28
189 0.3
190 0.32
191 0.32
192 0.28
193 0.28
194 0.3
195 0.29
196 0.3
197 0.32
198 0.31
199 0.29
200 0.25
201 0.21
202 0.19
203 0.18
204 0.12
205 0.08
206 0.07
207 0.07
208 0.07
209 0.08
210 0.09
211 0.11
212 0.12
213 0.12
214 0.13
215 0.13
216 0.15
217 0.17
218 0.19
219 0.25
220 0.25
221 0.3
222 0.3
223 0.35
224 0.38
225 0.37
226 0.33
227 0.25
228 0.23
229 0.18
230 0.17
231 0.14
232 0.09
233 0.1
234 0.09
235 0.09
236 0.09
237 0.09
238 0.09
239 0.06
240 0.05
241 0.04
242 0.04
243 0.05
244 0.05
245 0.08
246 0.09
247 0.1
248 0.11
249 0.1
250 0.11
251 0.11
252 0.12
253 0.09
254 0.08
255 0.11
256 0.15
257 0.14
258 0.14
259 0.12
260 0.13
261 0.15
262 0.15
263 0.13
264 0.09
265 0.09
266 0.09
267 0.1
268 0.1
269 0.08
270 0.09
271 0.07
272 0.07
273 0.07
274 0.07
275 0.07
276 0.05
277 0.05
278 0.04
279 0.05
280 0.06
281 0.07
282 0.1
283 0.12
284 0.15
285 0.18
286 0.2
287 0.28
288 0.32
289 0.4
290 0.48
291 0.56
292 0.65
293 0.71
294 0.8
295 0.8
296 0.83
297 0.78
298 0.75
299 0.69
300 0.67
301 0.6
302 0.53
303 0.44
304 0.36
305 0.32
306 0.25
307 0.21
308 0.14
309 0.14
310 0.11
311 0.13
312 0.16
313 0.17
314 0.17
315 0.18
316 0.18
317 0.21
318 0.31
319 0.32
320 0.31
321 0.35
322 0.37
323 0.35
324 0.36
325 0.38
326 0.36
327 0.35
328 0.39
329 0.36
330 0.38
331 0.43
332 0.42
333 0.37
334 0.28
335 0.26
336 0.2
337 0.19
338 0.17
339 0.13
340 0.13
341 0.12
342 0.12
343 0.12
344 0.11
345 0.12
346 0.08
347 0.08
348 0.06
349 0.06
350 0.11
351 0.12
352 0.15
353 0.15
354 0.19
355 0.19
356 0.21
357 0.3
358 0.3
359 0.34
360 0.4
361 0.49
362 0.57
363 0.66
364 0.75
365 0.75
366 0.77
367 0.81
368 0.81
369 0.8
370 0.78
371 0.76
372 0.74
373 0.71
374 0.7
375 0.66
376 0.59
377 0.5
378 0.41
379 0.36
380 0.3
381 0.25
382 0.19
383 0.15
384 0.13
385 0.14
386 0.16
387 0.13
388 0.12
389 0.12
390 0.14
391 0.19
392 0.22
393 0.23
394 0.21
395 0.22
396 0.21
397 0.2
398 0.2
399 0.15
400 0.13
401 0.11
402 0.1
403 0.1
404 0.1
405 0.09
406 0.07
407 0.06