Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7MY53

Protein Details
Accession A0A1C7MY53   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MTPGSFTKHSRVCPKRKKRSAGALARVQHydrophilic
NLS Segment(s)
PositionSequence
15-19KRKKR
Subcellular Location(s) mito 16, nucl 7.5, cyto_nucl 5.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MTPGSFTKHSRVCPKRKKRSAGALARVQELWASKRQRQDDSMPPEAQGVKTKTHTFGPLSSPLDAARVFDSASTTLYDLDARWQSVGPAEKIVCFPSGIET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.84
3 0.88
4 0.9
5 0.88
6 0.89
7 0.88
8 0.87
9 0.84
10 0.79
11 0.72
12 0.64
13 0.55
14 0.44
15 0.35
16 0.27
17 0.21
18 0.22
19 0.24
20 0.26
21 0.34
22 0.37
23 0.39
24 0.41
25 0.45
26 0.46
27 0.49
28 0.51
29 0.44
30 0.4
31 0.38
32 0.35
33 0.29
34 0.26
35 0.2
36 0.17
37 0.19
38 0.2
39 0.2
40 0.21
41 0.23
42 0.18
43 0.18
44 0.2
45 0.23
46 0.23
47 0.22
48 0.21
49 0.19
50 0.19
51 0.17
52 0.15
53 0.1
54 0.09
55 0.09
56 0.08
57 0.1
58 0.08
59 0.09
60 0.09
61 0.08
62 0.08
63 0.09
64 0.09
65 0.08
66 0.13
67 0.14
68 0.14
69 0.14
70 0.14
71 0.14
72 0.19
73 0.23
74 0.19
75 0.22
76 0.22
77 0.23
78 0.24
79 0.25
80 0.21
81 0.17