Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9FYT1

Protein Details
Accession A0A1B9FYT1    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
113-136ALNPKEREEWRKRKERPTGRQLFEBasic
NLS Segment(s)
PositionSequence
100-129RAKREKEEQDRVKALNPKEREEWRKRKERP
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040213  GIR2-like  
Amino Acid Sequences MSLQEIEGEGELREGEEDVVLDNLREIAEESIGMAMTFTIASAAKEALALLIVERARKEKEEDDRRTREYEEAEAARTRGTPLTRDLFDKWRKSFTAEIRAKREKEEQDRVKALNPKEREEWRKRKERPTGRQLFESSSALATSDEGLYEEGVEEVDMRKYTREQREEERRKEEEEEERRRRGLVNDGDSDNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.06
5 0.07
6 0.08
7 0.08
8 0.07
9 0.07
10 0.07
11 0.07
12 0.07
13 0.07
14 0.07
15 0.07
16 0.07
17 0.07
18 0.07
19 0.07
20 0.07
21 0.05
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.05
28 0.05
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.05
35 0.05
36 0.05
37 0.04
38 0.07
39 0.08
40 0.09
41 0.1
42 0.13
43 0.14
44 0.16
45 0.2
46 0.23
47 0.33
48 0.43
49 0.51
50 0.57
51 0.61
52 0.62
53 0.6
54 0.55
55 0.48
56 0.39
57 0.33
58 0.28
59 0.23
60 0.23
61 0.21
62 0.19
63 0.17
64 0.15
65 0.14
66 0.12
67 0.12
68 0.12
69 0.15
70 0.18
71 0.19
72 0.21
73 0.23
74 0.28
75 0.34
76 0.38
77 0.36
78 0.36
79 0.35
80 0.36
81 0.39
82 0.35
83 0.4
84 0.4
85 0.43
86 0.48
87 0.53
88 0.51
89 0.48
90 0.5
91 0.46
92 0.48
93 0.53
94 0.51
95 0.51
96 0.54
97 0.51
98 0.5
99 0.49
100 0.44
101 0.42
102 0.39
103 0.36
104 0.39
105 0.46
106 0.5
107 0.55
108 0.63
109 0.63
110 0.71
111 0.75
112 0.79
113 0.82
114 0.83
115 0.83
116 0.83
117 0.84
118 0.77
119 0.75
120 0.67
121 0.6
122 0.52
123 0.43
124 0.32
125 0.23
126 0.19
127 0.15
128 0.13
129 0.1
130 0.08
131 0.07
132 0.06
133 0.06
134 0.07
135 0.06
136 0.06
137 0.06
138 0.05
139 0.05
140 0.05
141 0.05
142 0.05
143 0.08
144 0.09
145 0.09
146 0.11
147 0.16
148 0.26
149 0.35
150 0.4
151 0.43
152 0.53
153 0.64
154 0.72
155 0.75
156 0.74
157 0.67
158 0.65
159 0.64
160 0.59
161 0.59
162 0.59
163 0.62
164 0.62
165 0.64
166 0.61
167 0.58
168 0.55
169 0.48
170 0.48
171 0.46
172 0.45
173 0.45