Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B9FY33

Protein Details
Accession A0A1B9FY33    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-42SGSLNRAKRARSCKNRTKKTRRNVFGKPKPNPVLHydrophilic
NLS Segment(s)
PositionSequence
15-37AKRARSCKNRTKKTRRNVFGKPK
Subcellular Location(s) mito 19, nucl 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MPVQINYTSGSLNRAKRARSCKNRTKKTRRNVFGKPKPNPVLLEVLENRSANPFGPISRSARGMDEQTRQNVVWEPWWTRRGDKRNESGRSSPDRENGRRPGEGGLKSVQVTERRLYSEQANIETVVSTDAHPGTESIETAQNRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.48
4 0.58
5 0.64
6 0.68
7 0.74
8 0.76
9 0.83
10 0.9
11 0.92
12 0.94
13 0.92
14 0.92
15 0.93
16 0.91
17 0.88
18 0.88
19 0.88
20 0.87
21 0.87
22 0.82
23 0.8
24 0.76
25 0.7
26 0.61
27 0.52
28 0.47
29 0.37
30 0.38
31 0.29
32 0.28
33 0.28
34 0.26
35 0.23
36 0.2
37 0.19
38 0.13
39 0.14
40 0.12
41 0.09
42 0.13
43 0.15
44 0.17
45 0.18
46 0.2
47 0.18
48 0.19
49 0.2
50 0.2
51 0.22
52 0.23
53 0.24
54 0.23
55 0.24
56 0.22
57 0.22
58 0.21
59 0.17
60 0.16
61 0.16
62 0.17
63 0.2
64 0.24
65 0.24
66 0.26
67 0.34
68 0.39
69 0.45
70 0.49
71 0.54
72 0.6
73 0.64
74 0.64
75 0.6
76 0.58
77 0.56
78 0.54
79 0.48
80 0.45
81 0.49
82 0.48
83 0.52
84 0.53
85 0.5
86 0.46
87 0.44
88 0.43
89 0.41
90 0.38
91 0.33
92 0.27
93 0.25
94 0.25
95 0.25
96 0.24
97 0.21
98 0.23
99 0.23
100 0.23
101 0.26
102 0.27
103 0.28
104 0.27
105 0.29
106 0.29
107 0.28
108 0.27
109 0.23
110 0.22
111 0.2
112 0.17
113 0.13
114 0.11
115 0.09
116 0.11
117 0.11
118 0.11
119 0.11
120 0.11
121 0.12
122 0.13
123 0.13
124 0.12
125 0.19