Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B9FWG8

Protein Details
Accession A0A1B9FWG8    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
211-230IEEEKKRKRAEKFGLNKPANBasic
NLS Segment(s)
PositionSequence
215-222KKRKRAEK
Subcellular Location(s) mito_nucl 11.333, nucl 11, mito 10.5, cyto_nucl 8.333, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003034  SAP_dom  
IPR036361  SAP_dom_sf  
Pfam View protein in Pfam  
PF02037  SAP  
PROSITE View protein in PROSITE  
PS50800  SAP  
Amino Acid Sequences MEAKLQKLKVTELKELLAKHHLVQTGKKDDLVKRLLDNNVGLDDEPAEELVDPDVTAPVPSVAQQSSAAPTTEVPPSNEVATEPNSNETPKELTPEQKALKARAERFGLPFNPNPTPKTKPPTTKNGTKEPAPTPAASAPAQKKDKADAIDTTSLGISEDVLAKRAAKFGLPEKKEVTPATVAAPASGKPVEKVESKKEEISPEMAEKIAIEEEKKRKRAEKFGLNKPANGSEPVCLLLNSILWSCREYH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.42
3 0.39
4 0.37
5 0.33
6 0.28
7 0.3
8 0.32
9 0.31
10 0.36
11 0.41
12 0.43
13 0.43
14 0.44
15 0.45
16 0.45
17 0.5
18 0.48
19 0.42
20 0.38
21 0.43
22 0.42
23 0.39
24 0.35
25 0.29
26 0.26
27 0.24
28 0.2
29 0.14
30 0.13
31 0.1
32 0.09
33 0.08
34 0.07
35 0.06
36 0.07
37 0.07
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.07
48 0.09
49 0.09
50 0.1
51 0.11
52 0.11
53 0.13
54 0.14
55 0.13
56 0.11
57 0.12
58 0.12
59 0.16
60 0.17
61 0.16
62 0.16
63 0.17
64 0.17
65 0.17
66 0.15
67 0.13
68 0.15
69 0.15
70 0.14
71 0.15
72 0.16
73 0.16
74 0.16
75 0.15
76 0.16
77 0.14
78 0.18
79 0.17
80 0.2
81 0.24
82 0.3
83 0.3
84 0.31
85 0.34
86 0.32
87 0.36
88 0.38
89 0.37
90 0.36
91 0.38
92 0.34
93 0.34
94 0.36
95 0.32
96 0.29
97 0.3
98 0.28
99 0.3
100 0.29
101 0.29
102 0.3
103 0.33
104 0.34
105 0.39
106 0.41
107 0.45
108 0.49
109 0.57
110 0.58
111 0.6
112 0.6
113 0.62
114 0.58
115 0.51
116 0.51
117 0.43
118 0.42
119 0.36
120 0.31
121 0.25
122 0.23
123 0.23
124 0.19
125 0.23
126 0.21
127 0.27
128 0.29
129 0.29
130 0.29
131 0.29
132 0.32
133 0.29
134 0.28
135 0.22
136 0.24
137 0.24
138 0.23
139 0.21
140 0.16
141 0.14
142 0.12
143 0.1
144 0.06
145 0.05
146 0.08
147 0.08
148 0.09
149 0.09
150 0.1
151 0.11
152 0.12
153 0.12
154 0.09
155 0.12
156 0.2
157 0.29
158 0.3
159 0.33
160 0.34
161 0.36
162 0.39
163 0.36
164 0.31
165 0.23
166 0.22
167 0.21
168 0.2
169 0.18
170 0.15
171 0.16
172 0.13
173 0.14
174 0.15
175 0.13
176 0.11
177 0.14
178 0.16
179 0.21
180 0.26
181 0.31
182 0.37
183 0.4
184 0.43
185 0.44
186 0.44
187 0.41
188 0.4
189 0.34
190 0.29
191 0.27
192 0.23
193 0.2
194 0.16
195 0.15
196 0.14
197 0.13
198 0.12
199 0.2
200 0.3
201 0.39
202 0.45
203 0.49
204 0.54
205 0.61
206 0.7
207 0.71
208 0.72
209 0.73
210 0.78
211 0.83
212 0.78
213 0.72
214 0.65
215 0.6
216 0.52
217 0.46
218 0.37
219 0.27
220 0.27
221 0.26
222 0.23
223 0.18
224 0.16
225 0.13
226 0.13
227 0.14
228 0.13
229 0.13
230 0.14