Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B9GE94

Protein Details
Accession A0A1B9GE94    Localization Confidence High Confidence Score 20.4
NoLS Segment(s)
PositionSequenceProtein Nature
126-154SSSSSRSRSRSPPRRKRSRRSPSASSRSGHydrophilic
182-205SDSDSEKVRKPRRRSSSVSGSRSRHydrophilic
NLS Segment(s)
PositionSequence
79-103KILKAKEEERRKEEEKKKGKESRKR
131-150RSRSRSPPRRKRSRRSPSAS
163-175RRRSASPAPRKRR
188-214KVRKPRRRSSSVSGSRSRSRSRSRSRS
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF13917  zf-CCHC_3  
Amino Acid Sequences MWRSGPRSMGSSDRAGPNTRCQKCLKLGHHTYQCSNPRPYVARPSRTKQLTSGKIGRDKPSVEVPEEFRAGSKVGLADKILKAKEEERRKEEEKKKGKESRKRSSSYSSSDTDSSSSSDSDSDSNSSSSSRSRSRSPPRRKRSRRSPSASSRSGSDSDSDVSRRRSASPAPRKRRYSSDPESDSDSEKVRKPRRRSSSVSGSRSRSRSRSRSRSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.41
4 0.45
5 0.52
6 0.51
7 0.51
8 0.49
9 0.53
10 0.57
11 0.64
12 0.6
13 0.6
14 0.65
15 0.7
16 0.74
17 0.71
18 0.65
19 0.65
20 0.66
21 0.62
22 0.58
23 0.5
24 0.48
25 0.48
26 0.49
27 0.51
28 0.52
29 0.54
30 0.57
31 0.62
32 0.65
33 0.65
34 0.62
35 0.59
36 0.6
37 0.57
38 0.58
39 0.58
40 0.55
41 0.59
42 0.61
43 0.58
44 0.52
45 0.46
46 0.42
47 0.43
48 0.39
49 0.34
50 0.32
51 0.32
52 0.31
53 0.3
54 0.27
55 0.2
56 0.19
57 0.17
58 0.14
59 0.11
60 0.09
61 0.09
62 0.1
63 0.1
64 0.13
65 0.13
66 0.18
67 0.17
68 0.16
69 0.17
70 0.22
71 0.3
72 0.36
73 0.41
74 0.42
75 0.48
76 0.52
77 0.61
78 0.64
79 0.66
80 0.66
81 0.66
82 0.71
83 0.73
84 0.79
85 0.78
86 0.79
87 0.8
88 0.78
89 0.74
90 0.68
91 0.66
92 0.62
93 0.57
94 0.51
95 0.42
96 0.36
97 0.33
98 0.3
99 0.24
100 0.19
101 0.15
102 0.12
103 0.1
104 0.08
105 0.08
106 0.08
107 0.08
108 0.08
109 0.09
110 0.09
111 0.09
112 0.09
113 0.09
114 0.09
115 0.11
116 0.15
117 0.18
118 0.2
119 0.25
120 0.35
121 0.46
122 0.56
123 0.65
124 0.72
125 0.78
126 0.87
127 0.92
128 0.93
129 0.93
130 0.93
131 0.92
132 0.89
133 0.88
134 0.87
135 0.86
136 0.79
137 0.69
138 0.6
139 0.52
140 0.46
141 0.37
142 0.27
143 0.2
144 0.18
145 0.19
146 0.2
147 0.2
148 0.22
149 0.25
150 0.25
151 0.25
152 0.28
153 0.34
154 0.43
155 0.5
156 0.57
157 0.65
158 0.73
159 0.77
160 0.77
161 0.78
162 0.75
163 0.73
164 0.71
165 0.71
166 0.66
167 0.61
168 0.63
169 0.55
170 0.51
171 0.43
172 0.4
173 0.34
174 0.36
175 0.44
176 0.48
177 0.56
178 0.62
179 0.7
180 0.75
181 0.79
182 0.81
183 0.81
184 0.82
185 0.82
186 0.81
187 0.78
188 0.75
189 0.74
190 0.73
191 0.71
192 0.69
193 0.69
194 0.72
195 0.76