Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9FWP7

Protein Details
Accession A0A1B9FWP7    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
191-212KSTWGYRKKLARAVREKRKEFWHydrophilic
NLS Segment(s)
PositionSequence
198-209KKLARAVREKRK
Subcellular Location(s) mito 23, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR024388  Ribosomal_L20_mt  
Amino Acid Sequences MASPTLASSSRTILSLPSISSLGSTRGVLHRARPPRIPVLQSPHTPKTPLPTSGTSHPVDPKIHGQPPSSSSSIVLEDTGLTFHHSPPPSLPSYTNGALPPLLQWVKGKSISLSGEEQAKKMVERRKYEGELEWSQELVDRMVQLRAEGKSRKEVGDALQLPADQYRLISRVAPQTSVQKASKLTELEEQKSTWGYRKKLARAVREKRKEFW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.17
4 0.15
5 0.15
6 0.14
7 0.15
8 0.15
9 0.14
10 0.13
11 0.13
12 0.14
13 0.17
14 0.21
15 0.22
16 0.26
17 0.33
18 0.4
19 0.44
20 0.46
21 0.48
22 0.53
23 0.57
24 0.56
25 0.53
26 0.53
27 0.55
28 0.56
29 0.58
30 0.55
31 0.51
32 0.48
33 0.43
34 0.42
35 0.41
36 0.38
37 0.36
38 0.35
39 0.37
40 0.39
41 0.44
42 0.36
43 0.34
44 0.34
45 0.32
46 0.3
47 0.28
48 0.3
49 0.31
50 0.35
51 0.35
52 0.34
53 0.33
54 0.35
55 0.38
56 0.32
57 0.26
58 0.22
59 0.21
60 0.2
61 0.17
62 0.13
63 0.08
64 0.08
65 0.07
66 0.07
67 0.06
68 0.07
69 0.07
70 0.08
71 0.14
72 0.15
73 0.15
74 0.17
75 0.21
76 0.2
77 0.21
78 0.21
79 0.17
80 0.21
81 0.21
82 0.21
83 0.17
84 0.16
85 0.15
86 0.14
87 0.11
88 0.11
89 0.11
90 0.09
91 0.1
92 0.11
93 0.14
94 0.15
95 0.14
96 0.1
97 0.13
98 0.13
99 0.15
100 0.15
101 0.13
102 0.19
103 0.19
104 0.19
105 0.17
106 0.17
107 0.15
108 0.2
109 0.25
110 0.26
111 0.3
112 0.36
113 0.41
114 0.43
115 0.44
116 0.41
117 0.42
118 0.36
119 0.35
120 0.29
121 0.23
122 0.21
123 0.2
124 0.18
125 0.11
126 0.1
127 0.08
128 0.08
129 0.1
130 0.1
131 0.09
132 0.12
133 0.13
134 0.18
135 0.21
136 0.22
137 0.29
138 0.31
139 0.31
140 0.29
141 0.29
142 0.26
143 0.33
144 0.32
145 0.25
146 0.24
147 0.24
148 0.23
149 0.21
150 0.19
151 0.09
152 0.09
153 0.1
154 0.1
155 0.11
156 0.12
157 0.15
158 0.22
159 0.24
160 0.25
161 0.25
162 0.31
163 0.34
164 0.39
165 0.37
166 0.32
167 0.33
168 0.34
169 0.37
170 0.31
171 0.29
172 0.31
173 0.35
174 0.36
175 0.36
176 0.34
177 0.3
178 0.33
179 0.32
180 0.32
181 0.35
182 0.35
183 0.41
184 0.49
185 0.55
186 0.6
187 0.67
188 0.69
189 0.72
190 0.79
191 0.83
192 0.85