Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B9GC08

Protein Details
Accession A0A1B9GC08    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
7-32RLYTKGRILGHKRGKRNSRPNQSLVQHydrophilic
NLS Segment(s)
PositionSequence
17-22HKRGKR
Subcellular Location(s) mito_nucl 12, nucl 11.5, mito 11.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MPTPTNRLYTKGRILGHKRGKRNSRPNQSLVQIEGVDSKEAARHYLGKRVAYVYKAKREINGSRVRVIWGRISRPHGNSGVAKAKFRTNLPAKVFGASCRIMLFPSTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.65
3 0.69
4 0.7
5 0.71
6 0.74
7 0.8
8 0.81
9 0.86
10 0.86
11 0.86
12 0.85
13 0.8
14 0.76
15 0.69
16 0.6
17 0.51
18 0.42
19 0.31
20 0.24
21 0.22
22 0.17
23 0.14
24 0.11
25 0.1
26 0.1
27 0.1
28 0.11
29 0.1
30 0.15
31 0.16
32 0.24
33 0.26
34 0.24
35 0.25
36 0.26
37 0.27
38 0.23
39 0.29
40 0.27
41 0.31
42 0.35
43 0.34
44 0.34
45 0.38
46 0.39
47 0.4
48 0.43
49 0.38
50 0.36
51 0.36
52 0.36
53 0.32
54 0.3
55 0.29
56 0.24
57 0.26
58 0.29
59 0.35
60 0.39
61 0.39
62 0.42
63 0.36
64 0.36
65 0.33
66 0.35
67 0.37
68 0.34
69 0.33
70 0.31
71 0.34
72 0.34
73 0.34
74 0.38
75 0.36
76 0.43
77 0.46
78 0.52
79 0.48
80 0.48
81 0.47
82 0.39
83 0.37
84 0.3
85 0.26
86 0.2
87 0.19
88 0.16