Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7ZK59

Protein Details
Accession C7ZK59    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
94-115REEFRNKIIQPQPQPRKRKRKRBasic
NLS Segment(s)
PositionSequence
107-115QPRKRKRKR
Subcellular Location(s) mito 11.5mito_nucl 11.5, nucl 10.5, cyto 4
Family & Domain DBs
KEGG nhe:NECHADRAFT_86820  -  
Amino Acid Sequences MGRQCKSTKKLLALFIDEIPDDKLLEFSDTPGEIYSQQNFRLDLQGKTSSGGWNLQIQVNYGAETEALQAMAPDTISGPVLVTLELPMTPEEIREEFRNKIIQPQPQPRKRKRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.45
3 0.39
4 0.31
5 0.26
6 0.21
7 0.17
8 0.12
9 0.1
10 0.1
11 0.09
12 0.12
13 0.11
14 0.1
15 0.12
16 0.12
17 0.12
18 0.12
19 0.12
20 0.11
21 0.13
22 0.16
23 0.16
24 0.17
25 0.19
26 0.19
27 0.19
28 0.24
29 0.24
30 0.21
31 0.23
32 0.24
33 0.23
34 0.23
35 0.23
36 0.17
37 0.15
38 0.16
39 0.12
40 0.12
41 0.13
42 0.13
43 0.12
44 0.12
45 0.12
46 0.12
47 0.11
48 0.09
49 0.08
50 0.06
51 0.06
52 0.06
53 0.05
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.03
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.05
73 0.06
74 0.06
75 0.07
76 0.07
77 0.08
78 0.11
79 0.12
80 0.15
81 0.19
82 0.23
83 0.23
84 0.27
85 0.32
86 0.29
87 0.37
88 0.41
89 0.45
90 0.52
91 0.61
92 0.68
93 0.72
94 0.83
95 0.84