Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B9G3G2

Protein Details
Accession A0A1B9G3G2    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
183-202TPSSQTTRPKTPRSRRKTMEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 7.5, cyto_nucl 6, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007128  PMF1/Nnf1  
Gene Ontology GO:0000444  C:MIS12/MIND type complex  
GO:0005634  C:nucleus  
GO:0007049  P:cell cycle  
GO:0051301  P:cell division  
Pfam View protein in Pfam  
PF03980  Nnf1  
Amino Acid Sequences MGLQRTPPHRSQPLPSVSPAPPPSAPAPTPQPEPATQHTEAVDIPRQVEPDRTTISNISDSKAFIPRHPGVMRTPPPESSTQAIPMSQGRVEHVDERPIRPAPIPRPEEPMNVDVPQLQSEMVVEDDISVEQQMTIEPEHSPENHTSHETMDIDVPLQQQQQRSTTPPPQAEAGPSTYIPPTTPSSQTTRPKTPRSRRKTMEPLPSPPRILPIEEDEYQFGRRYQLTMETLERAVKAGAQRWTADHLRGCFPQLTKELGKPMEDVCMAASQSMRNNILASAQSLMEHYKVGPALRAIDEVDKDAKDYRRLNPPESEGGKMGRPDAWRPDVSPNALTIASVLPVYDESYSKLREEYSELHKYCSEKYKTLVEKQNQLSELENGVSDGVIELEKTIQILDNLPMEDMMIWTESAETKLETRAPEQIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.59
3 0.56
4 0.49
5 0.54
6 0.49
7 0.44
8 0.36
9 0.37
10 0.37
11 0.37
12 0.37
13 0.33
14 0.39
15 0.39
16 0.43
17 0.42
18 0.43
19 0.4
20 0.45
21 0.46
22 0.45
23 0.42
24 0.4
25 0.36
26 0.33
27 0.31
28 0.3
29 0.29
30 0.23
31 0.24
32 0.23
33 0.25
34 0.24
35 0.3
36 0.27
37 0.28
38 0.3
39 0.29
40 0.31
41 0.31
42 0.33
43 0.34
44 0.32
45 0.28
46 0.26
47 0.26
48 0.26
49 0.32
50 0.3
51 0.25
52 0.33
53 0.33
54 0.39
55 0.39
56 0.39
57 0.36
58 0.45
59 0.49
60 0.45
61 0.46
62 0.4
63 0.42
64 0.42
65 0.4
66 0.34
67 0.3
68 0.29
69 0.27
70 0.26
71 0.24
72 0.24
73 0.23
74 0.2
75 0.18
76 0.16
77 0.18
78 0.2
79 0.23
80 0.22
81 0.29
82 0.3
83 0.32
84 0.35
85 0.33
86 0.32
87 0.31
88 0.37
89 0.36
90 0.43
91 0.47
92 0.44
93 0.5
94 0.51
95 0.51
96 0.47
97 0.41
98 0.34
99 0.29
100 0.28
101 0.22
102 0.21
103 0.18
104 0.15
105 0.12
106 0.09
107 0.09
108 0.09
109 0.07
110 0.06
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.04
118 0.04
119 0.04
120 0.05
121 0.05
122 0.06
123 0.07
124 0.07
125 0.08
126 0.1
127 0.11
128 0.13
129 0.15
130 0.17
131 0.18
132 0.2
133 0.19
134 0.18
135 0.21
136 0.19
137 0.16
138 0.15
139 0.14
140 0.12
141 0.13
142 0.13
143 0.11
144 0.13
145 0.15
146 0.17
147 0.19
148 0.22
149 0.22
150 0.26
151 0.3
152 0.33
153 0.37
154 0.35
155 0.34
156 0.33
157 0.31
158 0.29
159 0.25
160 0.2
161 0.16
162 0.15
163 0.14
164 0.13
165 0.13
166 0.11
167 0.12
168 0.13
169 0.15
170 0.17
171 0.18
172 0.23
173 0.31
174 0.39
175 0.42
176 0.48
177 0.52
178 0.6
179 0.68
180 0.74
181 0.76
182 0.77
183 0.81
184 0.75
185 0.78
186 0.79
187 0.77
188 0.77
189 0.7
190 0.68
191 0.64
192 0.62
193 0.54
194 0.43
195 0.39
196 0.29
197 0.26
198 0.2
199 0.18
200 0.21
201 0.21
202 0.21
203 0.18
204 0.18
205 0.19
206 0.18
207 0.14
208 0.12
209 0.11
210 0.11
211 0.11
212 0.14
213 0.15
214 0.17
215 0.17
216 0.17
217 0.17
218 0.17
219 0.16
220 0.12
221 0.1
222 0.1
223 0.1
224 0.13
225 0.16
226 0.17
227 0.17
228 0.18
229 0.23
230 0.22
231 0.24
232 0.21
233 0.2
234 0.22
235 0.22
236 0.23
237 0.21
238 0.2
239 0.22
240 0.21
241 0.24
242 0.23
243 0.24
244 0.27
245 0.25
246 0.25
247 0.22
248 0.2
249 0.18
250 0.17
251 0.15
252 0.11
253 0.11
254 0.11
255 0.1
256 0.1
257 0.09
258 0.11
259 0.14
260 0.14
261 0.13
262 0.13
263 0.13
264 0.14
265 0.13
266 0.12
267 0.1
268 0.09
269 0.09
270 0.09
271 0.1
272 0.09
273 0.09
274 0.08
275 0.09
276 0.1
277 0.1
278 0.11
279 0.1
280 0.12
281 0.13
282 0.14
283 0.13
284 0.14
285 0.14
286 0.15
287 0.17
288 0.14
289 0.15
290 0.19
291 0.22
292 0.26
293 0.3
294 0.33
295 0.42
296 0.46
297 0.48
298 0.48
299 0.49
300 0.5
301 0.48
302 0.45
303 0.36
304 0.34
305 0.33
306 0.29
307 0.26
308 0.21
309 0.22
310 0.23
311 0.29
312 0.32
313 0.31
314 0.33
315 0.39
316 0.39
317 0.39
318 0.36
319 0.29
320 0.26
321 0.25
322 0.22
323 0.16
324 0.12
325 0.1
326 0.08
327 0.08
328 0.06
329 0.06
330 0.08
331 0.08
332 0.08
333 0.11
334 0.15
335 0.17
336 0.17
337 0.18
338 0.17
339 0.18
340 0.22
341 0.25
342 0.29
343 0.38
344 0.38
345 0.4
346 0.41
347 0.42
348 0.43
349 0.47
350 0.44
351 0.38
352 0.41
353 0.48
354 0.52
355 0.6
356 0.64
357 0.6
358 0.64
359 0.66
360 0.68
361 0.6
362 0.54
363 0.47
364 0.4
365 0.35
366 0.26
367 0.21
368 0.15
369 0.13
370 0.12
371 0.09
372 0.07
373 0.06
374 0.05
375 0.05
376 0.05
377 0.06
378 0.07
379 0.07
380 0.07
381 0.08
382 0.09
383 0.11
384 0.13
385 0.16
386 0.16
387 0.16
388 0.15
389 0.14
390 0.13
391 0.12
392 0.1
393 0.08
394 0.07
395 0.07
396 0.09
397 0.09
398 0.1
399 0.11
400 0.12
401 0.12
402 0.16
403 0.2
404 0.22
405 0.24