Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9G2Q0

Protein Details
Accession A0A1B9G2Q0    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-44NELKPLIKTPTKKRKKSPSTSPRKERKAWTHydrophilic
NLS Segment(s)
PositionSequence
22-41KTPTKKRKKSPSTSPRKERK
Subcellular Location(s) nucl 18, mito_nucl 12.833, cyto_nucl 10.333, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001005  SANT/Myb  
PROSITE View protein in PROSITE  
PS50090  MYB_LIKE  
Amino Acid Sequences MPVKRDNSSTSDSENELKPLIKTPTKKRKKSPSTSPRKERKAWTEIAATQFKEAINNIVKKNIWAEVKNHFPGLAGNRSADVCINHWGAIFDPLQCVFIFFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.28
3 0.25
4 0.23
5 0.2
6 0.23
7 0.26
8 0.29
9 0.35
10 0.45
11 0.55
12 0.64
13 0.72
14 0.77
15 0.82
16 0.86
17 0.87
18 0.88
19 0.88
20 0.88
21 0.9
22 0.91
23 0.9
24 0.86
25 0.82
26 0.78
27 0.75
28 0.69
29 0.62
30 0.54
31 0.48
32 0.43
33 0.42
34 0.37
35 0.29
36 0.24
37 0.22
38 0.19
39 0.16
40 0.13
41 0.13
42 0.15
43 0.19
44 0.19
45 0.21
46 0.21
47 0.21
48 0.23
49 0.23
50 0.21
51 0.19
52 0.21
53 0.24
54 0.31
55 0.31
56 0.3
57 0.25
58 0.22
59 0.24
60 0.26
61 0.25
62 0.2
63 0.19
64 0.2
65 0.2
66 0.21
67 0.19
68 0.15
69 0.12
70 0.16
71 0.17
72 0.16
73 0.16
74 0.16
75 0.15
76 0.18
77 0.16
78 0.12
79 0.14
80 0.14
81 0.15
82 0.14