Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9FUK3

Protein Details
Accession A0A1B9FUK3    Localization Confidence High Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
6-56APPHLSPRDRDRDRRYGRDDRAVAGDRARTRSRSRSPRRDRDRYDDRDRKYBasic
264-285GVAKVNKQRSWRQYMNRRGGFNHydrophilic
NLS Segment(s)
PositionSequence
19-50RRYGRDDRAVAGDRARTRSRSRSPRRDRDRYD
52-54RDR
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences MSSRPAPPHLSPRDRDRDRRYGRDDRAVAGDRARTRSRSRSPRRDRDRYDDRDRKYGRESGRSGYRDDRSRRDYDSPRDRDRRDDYSRDERRGEYTRDNRRDDYNRSEVKPELTTRDPPRGAYSRDNPNSDPNYRPSPRPYEDRPPAGAAPSAPPSQPRGGPSARPGFRAGYGGYANGGGDYDRPLDRRAIEEGRRRREEERAKGIVYTEEGAYNPSAEASPAPKEEPEDEIDPDDPEAQMAAMMGFGGFGSSKGQAKEDNIDGVAKVNKQRSWRQYMNRRGGFNRPLDKIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.79
3 0.78
4 0.78
5 0.79
6 0.83
7 0.82
8 0.81
9 0.8
10 0.8
11 0.73
12 0.65
13 0.63
14 0.57
15 0.5
16 0.43
17 0.43
18 0.37
19 0.42
20 0.43
21 0.4
22 0.43
23 0.51
24 0.58
25 0.63
26 0.7
27 0.75
28 0.82
29 0.88
30 0.92
31 0.93
32 0.9
33 0.88
34 0.88
35 0.85
36 0.86
37 0.83
38 0.77
39 0.77
40 0.72
41 0.66
42 0.61
43 0.6
44 0.55
45 0.55
46 0.53
47 0.49
48 0.56
49 0.53
50 0.51
51 0.51
52 0.52
53 0.52
54 0.55
55 0.56
56 0.54
57 0.55
58 0.57
59 0.58
60 0.6
61 0.61
62 0.66
63 0.65
64 0.69
65 0.74
66 0.71
67 0.7
68 0.68
69 0.67
70 0.63
71 0.62
72 0.59
73 0.62
74 0.67
75 0.63
76 0.59
77 0.52
78 0.5
79 0.5
80 0.47
81 0.46
82 0.48
83 0.54
84 0.59
85 0.62
86 0.58
87 0.6
88 0.62
89 0.58
90 0.56
91 0.54
92 0.52
93 0.49
94 0.5
95 0.44
96 0.4
97 0.38
98 0.32
99 0.28
100 0.26
101 0.32
102 0.32
103 0.39
104 0.37
105 0.34
106 0.38
107 0.37
108 0.38
109 0.37
110 0.4
111 0.42
112 0.46
113 0.48
114 0.43
115 0.46
116 0.46
117 0.42
118 0.39
119 0.33
120 0.37
121 0.36
122 0.37
123 0.35
124 0.38
125 0.39
126 0.42
127 0.44
128 0.45
129 0.49
130 0.49
131 0.46
132 0.41
133 0.38
134 0.32
135 0.27
136 0.18
137 0.14
138 0.14
139 0.13
140 0.11
141 0.12
142 0.15
143 0.16
144 0.17
145 0.17
146 0.19
147 0.2
148 0.21
149 0.26
150 0.32
151 0.31
152 0.32
153 0.32
154 0.28
155 0.27
156 0.27
157 0.21
158 0.15
159 0.14
160 0.12
161 0.11
162 0.1
163 0.09
164 0.07
165 0.07
166 0.04
167 0.04
168 0.05
169 0.07
170 0.08
171 0.1
172 0.11
173 0.13
174 0.14
175 0.16
176 0.2
177 0.24
178 0.3
179 0.38
180 0.46
181 0.53
182 0.56
183 0.57
184 0.54
185 0.58
186 0.6
187 0.6
188 0.6
189 0.54
190 0.51
191 0.49
192 0.47
193 0.38
194 0.29
195 0.22
196 0.14
197 0.11
198 0.1
199 0.11
200 0.11
201 0.1
202 0.08
203 0.07
204 0.07
205 0.07
206 0.08
207 0.09
208 0.12
209 0.13
210 0.14
211 0.14
212 0.17
213 0.18
214 0.2
215 0.22
216 0.21
217 0.21
218 0.22
219 0.22
220 0.2
221 0.2
222 0.17
223 0.13
224 0.1
225 0.09
226 0.07
227 0.06
228 0.05
229 0.04
230 0.04
231 0.04
232 0.03
233 0.03
234 0.03
235 0.03
236 0.03
237 0.04
238 0.06
239 0.09
240 0.12
241 0.13
242 0.15
243 0.18
244 0.21
245 0.26
246 0.26
247 0.26
248 0.24
249 0.23
250 0.22
251 0.23
252 0.24
253 0.22
254 0.26
255 0.3
256 0.33
257 0.4
258 0.49
259 0.54
260 0.6
261 0.66
262 0.7
263 0.75
264 0.82
265 0.86
266 0.83
267 0.8
268 0.74
269 0.74
270 0.71
271 0.7
272 0.67