Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7Z298

Protein Details
Accession C7Z298   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
157-186IVDAPREDRKTRRRKKKRDKKKGITSDSDSBasic
NLS Segment(s)
PositionSequence
164-179DRKTRRRKKKRDKKKG
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR036533  BAG_dom_sf  
IPR003103  BAG_domain  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0051087  F:protein-folding chaperone binding  
KEGG nhe:NECHADRAFT_101954  -  
Pfam View protein in Pfam  
PF02179  BAG  
PROSITE View protein in PROSITE  
PS51035  BAG  
PS50053  UBIQUITIN_2  
Amino Acid Sequences MSRYGWSISREQLSPYGSVPGDVPAVTDDDFSYITSQDLDDVTEAQYYPRSHSAAPPAPEDDVLLIKNRGVTYPAHFPAYAIGDGKLRVIDVKDRVGLMMELPVRGTSRIKLLYKGKQLKDPLAPVRDYGVKNNSELMAVIPEIEDISSPSDEEMVIVDAPREDRKTRRRKKKRDKKKGITSDSDSMSASNPRDSTSTFDQPRSPPAPPVSSGATSGPMKALDDLAVEFQIKWLPLCTDYIEAPPSDPKKREEDHRKVSESIMQHIMLKLDCIDSEGIAEVRARRKELVQQVQKTLKQLDVAKDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.27
4 0.23
5 0.23
6 0.2
7 0.17
8 0.16
9 0.15
10 0.14
11 0.1
12 0.12
13 0.12
14 0.12
15 0.1
16 0.11
17 0.11
18 0.11
19 0.12
20 0.1
21 0.1
22 0.1
23 0.1
24 0.09
25 0.09
26 0.09
27 0.09
28 0.09
29 0.1
30 0.1
31 0.1
32 0.1
33 0.15
34 0.15
35 0.19
36 0.22
37 0.23
38 0.23
39 0.28
40 0.36
41 0.38
42 0.39
43 0.38
44 0.35
45 0.34
46 0.33
47 0.29
48 0.21
49 0.16
50 0.14
51 0.14
52 0.12
53 0.12
54 0.15
55 0.15
56 0.14
57 0.14
58 0.15
59 0.17
60 0.25
61 0.26
62 0.25
63 0.25
64 0.24
65 0.25
66 0.26
67 0.23
68 0.15
69 0.14
70 0.13
71 0.14
72 0.14
73 0.11
74 0.08
75 0.09
76 0.09
77 0.14
78 0.15
79 0.17
80 0.18
81 0.18
82 0.18
83 0.17
84 0.16
85 0.11
86 0.13
87 0.11
88 0.1
89 0.1
90 0.11
91 0.1
92 0.12
93 0.13
94 0.09
95 0.13
96 0.19
97 0.2
98 0.26
99 0.32
100 0.38
101 0.47
102 0.55
103 0.52
104 0.53
105 0.54
106 0.52
107 0.49
108 0.48
109 0.43
110 0.38
111 0.36
112 0.3
113 0.3
114 0.31
115 0.28
116 0.26
117 0.26
118 0.23
119 0.23
120 0.24
121 0.22
122 0.16
123 0.15
124 0.12
125 0.07
126 0.06
127 0.06
128 0.05
129 0.04
130 0.04
131 0.04
132 0.04
133 0.03
134 0.05
135 0.05
136 0.05
137 0.05
138 0.05
139 0.05
140 0.05
141 0.05
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.06
148 0.07
149 0.1
150 0.11
151 0.19
152 0.3
153 0.41
154 0.51
155 0.62
156 0.72
157 0.81
158 0.91
159 0.94
160 0.95
161 0.96
162 0.97
163 0.96
164 0.96
165 0.95
166 0.9
167 0.85
168 0.78
169 0.71
170 0.61
171 0.51
172 0.4
173 0.3
174 0.25
175 0.22
176 0.17
177 0.15
178 0.13
179 0.13
180 0.14
181 0.15
182 0.19
183 0.22
184 0.3
185 0.3
186 0.32
187 0.35
188 0.35
189 0.41
190 0.39
191 0.34
192 0.3
193 0.31
194 0.32
195 0.3
196 0.31
197 0.28
198 0.25
199 0.25
200 0.21
201 0.21
202 0.19
203 0.17
204 0.15
205 0.12
206 0.12
207 0.11
208 0.11
209 0.08
210 0.08
211 0.08
212 0.08
213 0.09
214 0.09
215 0.08
216 0.08
217 0.1
218 0.09
219 0.09
220 0.09
221 0.1
222 0.11
223 0.12
224 0.14
225 0.14
226 0.15
227 0.17
228 0.17
229 0.16
230 0.16
231 0.23
232 0.26
233 0.31
234 0.33
235 0.34
236 0.41
237 0.45
238 0.55
239 0.58
240 0.63
241 0.67
242 0.72
243 0.73
244 0.66
245 0.64
246 0.59
247 0.5
248 0.44
249 0.37
250 0.3
251 0.27
252 0.26
253 0.26
254 0.2
255 0.19
256 0.15
257 0.12
258 0.11
259 0.12
260 0.11
261 0.09
262 0.1
263 0.11
264 0.1
265 0.1
266 0.12
267 0.15
268 0.23
269 0.26
270 0.28
271 0.29
272 0.32
273 0.41
274 0.49
275 0.55
276 0.58
277 0.6
278 0.67
279 0.73
280 0.72
281 0.67
282 0.6
283 0.51
284 0.47
285 0.47