Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B9FYC6

Protein Details
Accession A0A1B9FYC6    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
22-47FTPPSKYGWSWPKKVFKKKITSYLFGHydrophilic
NLS Segment(s)
Subcellular Location(s) golg 7, nucl 5, E.R. 5, mito 4, plas 3, vacu 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR006813  Glyco_trans_17  
Gene Ontology GO:0016020  C:membrane  
GO:0003830  F:beta-1,4-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity  
GO:0006487  P:protein N-linked glycosylation  
Pfam View protein in Pfam  
PF04724  Glyco_transf_17  
Amino Acid Sequences MPSSAFDVESGRFKHKRGGSAFTPPSKYGWSWPKKVFKKKITSYLFGITLLLILYAYLSGTLGTWKRDIGYILRPLWDTPEGGWNYITQYPPPGDLKDAEVRRKWCQLHGWDVRTARDPEPPKLIDAILFSSELDMLEIRMREYEPYVSKFLIVESNMTFSGQPKRTYFLDNRHEFDFIPESKIEYHLITDFEANLPVGSFDNEIKQRTKIGNELRNLANSGEIRKGDMIIQSDVDEIISRQTLQLLRTCSSIPSPLHLNVDNYRYTFQFPLNDGGYYRPKIVRYDTIDSLAYNHGRASNDLLGGSGWHCSFCFATISEIRAKMLGYSHNDRVRHKGLLEPKKLRKTVCEGRDPFDMFPEAFTFKDFIAQSGRPRKADSFNHVPIALKESPDKFRYLLDGGCERPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.45
3 0.52
4 0.5
5 0.55
6 0.51
7 0.59
8 0.65
9 0.63
10 0.62
11 0.54
12 0.51
13 0.48
14 0.44
15 0.43
16 0.46
17 0.48
18 0.51
19 0.59
20 0.68
21 0.74
22 0.83
23 0.85
24 0.84
25 0.86
26 0.86
27 0.88
28 0.84
29 0.79
30 0.72
31 0.67
32 0.58
33 0.47
34 0.38
35 0.28
36 0.21
37 0.16
38 0.11
39 0.06
40 0.04
41 0.04
42 0.04
43 0.04
44 0.03
45 0.04
46 0.04
47 0.04
48 0.09
49 0.11
50 0.14
51 0.15
52 0.15
53 0.16
54 0.18
55 0.19
56 0.19
57 0.24
58 0.29
59 0.3
60 0.31
61 0.31
62 0.3
63 0.32
64 0.29
65 0.23
66 0.17
67 0.24
68 0.23
69 0.23
70 0.23
71 0.19
72 0.21
73 0.24
74 0.24
75 0.15
76 0.18
77 0.18
78 0.22
79 0.23
80 0.21
81 0.2
82 0.2
83 0.24
84 0.29
85 0.34
86 0.37
87 0.4
88 0.43
89 0.45
90 0.52
91 0.49
92 0.45
93 0.48
94 0.46
95 0.51
96 0.55
97 0.53
98 0.51
99 0.51
100 0.48
101 0.45
102 0.44
103 0.35
104 0.35
105 0.36
106 0.34
107 0.39
108 0.38
109 0.34
110 0.31
111 0.3
112 0.23
113 0.21
114 0.19
115 0.13
116 0.12
117 0.11
118 0.1
119 0.1
120 0.08
121 0.07
122 0.05
123 0.05
124 0.07
125 0.08
126 0.08
127 0.09
128 0.09
129 0.09
130 0.11
131 0.15
132 0.16
133 0.19
134 0.21
135 0.2
136 0.2
137 0.19
138 0.19
139 0.17
140 0.14
141 0.12
142 0.11
143 0.13
144 0.12
145 0.13
146 0.12
147 0.11
148 0.2
149 0.21
150 0.24
151 0.23
152 0.27
153 0.28
154 0.34
155 0.36
156 0.37
157 0.43
158 0.44
159 0.45
160 0.43
161 0.42
162 0.36
163 0.34
164 0.29
165 0.2
166 0.19
167 0.16
168 0.16
169 0.16
170 0.17
171 0.16
172 0.11
173 0.11
174 0.1
175 0.1
176 0.1
177 0.1
178 0.09
179 0.08
180 0.08
181 0.07
182 0.06
183 0.05
184 0.05
185 0.05
186 0.05
187 0.06
188 0.06
189 0.1
190 0.12
191 0.14
192 0.15
193 0.15
194 0.18
195 0.19
196 0.2
197 0.23
198 0.29
199 0.33
200 0.34
201 0.37
202 0.34
203 0.34
204 0.33
205 0.26
206 0.21
207 0.15
208 0.16
209 0.14
210 0.13
211 0.13
212 0.13
213 0.13
214 0.12
215 0.13
216 0.14
217 0.11
218 0.12
219 0.11
220 0.11
221 0.11
222 0.09
223 0.07
224 0.05
225 0.05
226 0.05
227 0.05
228 0.05
229 0.08
230 0.1
231 0.11
232 0.15
233 0.17
234 0.18
235 0.19
236 0.19
237 0.17
238 0.17
239 0.21
240 0.17
241 0.16
242 0.19
243 0.19
244 0.22
245 0.22
246 0.24
247 0.22
248 0.25
249 0.24
250 0.21
251 0.21
252 0.19
253 0.2
254 0.19
255 0.18
256 0.18
257 0.19
258 0.22
259 0.22
260 0.21
261 0.2
262 0.22
263 0.26
264 0.23
265 0.24
266 0.22
267 0.23
268 0.26
269 0.29
270 0.32
271 0.34
272 0.38
273 0.37
274 0.36
275 0.35
276 0.32
277 0.3
278 0.27
279 0.21
280 0.16
281 0.15
282 0.16
283 0.16
284 0.17
285 0.2
286 0.18
287 0.18
288 0.17
289 0.17
290 0.13
291 0.13
292 0.13
293 0.1
294 0.08
295 0.08
296 0.08
297 0.09
298 0.1
299 0.1
300 0.12
301 0.1
302 0.15
303 0.16
304 0.2
305 0.23
306 0.23
307 0.22
308 0.21
309 0.2
310 0.17
311 0.17
312 0.2
313 0.22
314 0.28
315 0.35
316 0.4
317 0.44
318 0.45
319 0.5
320 0.49
321 0.45
322 0.4
323 0.4
324 0.45
325 0.52
326 0.59
327 0.61
328 0.67
329 0.73
330 0.76
331 0.7
332 0.66
333 0.66
334 0.66
335 0.64
336 0.65
337 0.59
338 0.59
339 0.65
340 0.61
341 0.51
342 0.45
343 0.39
344 0.29
345 0.27
346 0.26
347 0.2
348 0.18
349 0.19
350 0.16
351 0.14
352 0.2
353 0.19
354 0.18
355 0.22
356 0.26
357 0.34
358 0.43
359 0.49
360 0.44
361 0.48
362 0.51
363 0.54
364 0.59
365 0.58
366 0.58
367 0.57
368 0.59
369 0.56
370 0.52
371 0.44
372 0.43
373 0.37
374 0.29
375 0.31
376 0.32
377 0.39
378 0.39
379 0.4
380 0.34
381 0.34
382 0.37
383 0.34
384 0.31
385 0.3
386 0.34