FuNGI

A0A1B9FXG9

Protein Details

Accession

A0A1B9FXG9

Localization Confidence

Medium

Confidence Score

12.5

NoLS Segment(s)

Position	Sequence	Protein Nature
136-155	STSTPTKKKKGGKIDKSLIS	Hydrophilic

NLS Segment(s)

Position	Sequence
142-147	KKKKGG
238-357	PKKPPPPPAPTSRRKPAPPPPASRSARPSSVAIPTAPPPPPGRTSLPPTAPPPPPPPVAPPRSSMPPPPPSFGAPPPPPPPPAPPRSGGSAPPPPPPPPPPGRGAPPPPPPPPTSGRAPP

Subcellular Location(s)

nucl 8.5, cyto_nucl 7.5, mito 6, cyto 5.5, extr 3, plas 1, pero 1, cysk 1, vacu 1

Family & Domain DBs

InterPro	View protein in InterPro IPR000095 CRIB_dom IPR036936 CRIB_dom_sf IPR011993 PH-like_dom_sf IPR011026 WAS_C IPR033927 WASPfam_EVH1 IPR000697 WH1/EVH1_dom IPR003124 WH2_dom
Gene Ontology	GO:0030479 C:actin cortical patch GO:0005634 C:nucleus GO:0003779 F:actin binding GO:0007015 P:actin filament organization
Pfam	View protein in Pfam PF00786 PBD PF00568 WH1
PROSITE	View protein in PROSITE PS50108 CRIB PS50229 WH1 PS51082 WH2
CDD	cd00132 CRIB cd01205 EVH1_WASP-like

Amino Acid Sequences

MGASTTLSSDDKAKVKKAVPSSSSTNKIVTATVARVYQCRSGSSSWSYAGSEGALVFCADKAKGGLWFRVVDLSSYRGVIWEHELPNEIEYNQEKPFFHSWQGDNSQFAFVFASEQEAHDFYKKVANRSKYATSASTSTPTKKKKGGKIDKSLISGPSAGSFKHVAHMGFDSEKGFSSSGVDPSWQALLEQLSMKGISAKDIQQNEKFIKDFVQQQGGIEKASHHSLFTFTSSHASAPKKPPPPPAPTSRRKPAPPPPASRSARPSSVAIPTAPPPPPGRTSLPPTAPPPPPPPVAPPRSSMPPPPPSFGAPPPPPPPPAPPRSGGSAPPPPPPPPPPGRGAPPPPPPPPTSGRAPPAPPAPPLPSTGGDTGRSALLASIQGKGVHNLKKVDASEQRVSPLAGGAAAVGAGAVVGAGAAAAVAATTEDTPDLASSLAAALSKRKADIGSDDEDDSDDDEWD

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.41
2	0.45
3	0.51
4	0.56
5	0.59
6	0.56
7	0.57
8	0.6
9	0.61
10	0.63
11	0.57
12	0.5
13	0.43
14	0.4
15	0.35
16	0.3
17	0.25
18	0.22
19	0.22
20	0.24
21	0.23
22	0.25
23	0.28
24	0.31
25	0.28
26	0.28
27	0.29
28	0.29
29	0.33
30	0.35
31	0.35
32	0.3
33	0.3
34	0.28
35	0.25
36	0.23
37	0.18
38	0.13
39	0.11
40	0.09
41	0.08
42	0.07
43	0.07
44	0.07
45	0.09
46	0.08
47	0.09
48	0.1
49	0.11
50	0.17
51	0.19
52	0.21
53	0.22
54	0.23
55	0.23
56	0.26
57	0.25
58	0.2
59	0.19
60	0.19
61	0.17
62	0.17
63	0.16
64	0.14
65	0.14
66	0.14
67	0.17
68	0.21
69	0.21
70	0.21
71	0.24
72	0.23
73	0.24
74	0.24
75	0.18
76	0.16
77	0.17
78	0.19
79	0.19
80	0.23
81	0.22
82	0.26
83	0.31
84	0.29
85	0.32
86	0.35
87	0.34
88	0.38
89	0.43
90	0.39
91	0.36
92	0.35
93	0.33
94	0.26
95	0.25
96	0.18
97	0.12
98	0.12
99	0.1
100	0.12
101	0.1
102	0.11
103	0.12
104	0.13
105	0.14
106	0.15
107	0.16
108	0.13
109	0.2
110	0.22
111	0.28
112	0.35
113	0.39
114	0.4
115	0.45
116	0.49
117	0.45
118	0.45
119	0.39
120	0.34
121	0.31
122	0.29
123	0.28
124	0.27
125	0.3
126	0.35
127	0.39
128	0.43
129	0.48
130	0.55
131	0.59
132	0.68
133	0.73
134	0.74
135	0.78
136	0.8
137	0.76
138	0.71
139	0.64
140	0.54
141	0.43
142	0.34
143	0.24
144	0.19
145	0.16
146	0.12
147	0.13
148	0.13
149	0.12
150	0.14
151	0.16
152	0.13
153	0.14
154	0.15
155	0.14
156	0.13
157	0.14
158	0.12
159	0.11
160	0.11
161	0.11
162	0.1
163	0.08
164	0.11
165	0.11
166	0.12
167	0.12
168	0.12
169	0.11
170	0.12
171	0.13
172	0.09
173	0.07
174	0.07
175	0.07
176	0.08
177	0.08
178	0.07
179	0.07
180	0.07
181	0.07
182	0.09
183	0.08
184	0.09
185	0.11
186	0.14
187	0.18
188	0.22
189	0.26
190	0.26
191	0.3
192	0.29
193	0.29
194	0.26
195	0.21
196	0.21
197	0.19
198	0.23
199	0.21
200	0.24
201	0.22
202	0.22
203	0.23
204	0.21
205	0.19
206	0.13
207	0.12
208	0.09
209	0.11
210	0.11
211	0.09
212	0.09
213	0.1
214	0.11
215	0.11
216	0.11
217	0.08
218	0.1
219	0.11
220	0.11
221	0.15
222	0.16
223	0.21
224	0.26
225	0.34
226	0.38
227	0.41
228	0.49
229	0.5
230	0.55
231	0.54
232	0.58
233	0.59
234	0.62
235	0.66
236	0.65
237	0.65
238	0.61
239	0.64
240	0.64
241	0.66
242	0.65
243	0.65
244	0.63
245	0.67
246	0.67
247	0.62
248	0.59
249	0.51
250	0.46
251	0.4
252	0.36
253	0.29
254	0.29
255	0.26
256	0.2
257	0.18
258	0.18
259	0.2
260	0.19
261	0.19
262	0.19
263	0.21
264	0.23
265	0.25
266	0.28
267	0.28
268	0.34
269	0.37
270	0.38
271	0.37
272	0.38
273	0.4
274	0.38
275	0.38
276	0.36
277	0.35
278	0.34
279	0.32
280	0.36
281	0.38
282	0.42
283	0.39
284	0.38
285	0.37
286	0.41
287	0.41
288	0.4
289	0.39
290	0.42
291	0.42
292	0.42
293	0.4
294	0.38
295	0.4
296	0.38
297	0.39
298	0.33
299	0.36
300	0.37
301	0.38
302	0.38
303	0.37
304	0.41
305	0.41
306	0.43
307	0.41
308	0.4
309	0.4
310	0.42
311	0.42
312	0.37
313	0.35
314	0.39
315	0.37
316	0.39
317	0.4
318	0.37
319	0.4
320	0.42
321	0.43
322	0.4
323	0.42
324	0.41
325	0.42
326	0.45
327	0.48
328	0.51
329	0.52
330	0.54
331	0.57
332	0.57
333	0.57
334	0.53
335	0.51
336	0.49
337	0.46
338	0.43
339	0.43
340	0.44
341	0.44
342	0.44
343	0.43
344	0.44
345	0.42
346	0.37
347	0.35
348	0.34
349	0.31
350	0.32
351	0.31
352	0.27
353	0.28
354	0.29
355	0.28
356	0.25
357	0.24
358	0.22
359	0.19
360	0.17
361	0.14
362	0.1
363	0.09
364	0.11
365	0.11
366	0.12
367	0.13
368	0.15
369	0.16
370	0.2
371	0.25
372	0.28
373	0.31
374	0.32
375	0.33
376	0.36
377	0.37
378	0.41
379	0.42
380	0.43
381	0.44
382	0.43
383	0.44
384	0.39
385	0.38
386	0.3
387	0.24
388	0.17
389	0.11
390	0.09
391	0.07
392	0.06
393	0.05
394	0.04
395	0.03
396	0.02
397	0.02
398	0.02
399	0.02
400	0.01
401	0.01
402	0.01
403	0.01
404	0.01
405	0.01
406	0.01
407	0.01
408	0.01
409	0.02
410	0.02
411	0.03
412	0.04
413	0.05
414	0.05
415	0.05
416	0.06
417	0.07
418	0.07
419	0.06
420	0.06
421	0.06
422	0.06
423	0.07
424	0.08
425	0.08
426	0.12
427	0.17
428	0.19
429	0.19
430	0.21
431	0.22
432	0.24
433	0.3
434	0.3
435	0.31
436	0.32
437	0.32
438	0.3
439	0.29
440	0.27
441	0.22

A0A1B9FXG9

3D AlphaFold-predicted Structure Viewer