Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9G1Y3

Protein Details
Accession A0A1B9G1Y3    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
17-45TSEPEPKKSRTSSRSKSKPQTRHEPTDEFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR027450  AlkB-like  
IPR037151  AlkB-like_sf  
IPR032854  ALKBH3  
Gene Ontology GO:0051213  F:dioxygenase activity  
GO:0006307  P:DNA dealkylation involved in DNA repair  
GO:0035552  P:oxidative single-stranded DNA demethylation  
Pfam View protein in Pfam  
PF13532  2OG-FeII_Oxy_2  
Amino Acid Sequences MPSRKRASSSSLSPPPTSEPEPKKSRTSSRSKSKPQTRHEPTDEFQQVTLPSFVDRWKVGDMGYGGDVYYQPDFIEAEEAQGWYDELLNLDTYQPTLKLYGRTFPQSRQIAAYSTVPDATLSYSGSEITMHYPFPPILETIRKQLEEELGVRFNHCMLNRYDDGSVYIGKHSDNLNNLVIASISLGAERRFIMSPRLPSKAGKQTMPTKEVEEELEARKNISWM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.5
3 0.48
4 0.47
5 0.47
6 0.46
7 0.51
8 0.58
9 0.6
10 0.63
11 0.64
12 0.69
13 0.68
14 0.71
15 0.72
16 0.76
17 0.82
18 0.85
19 0.88
20 0.89
21 0.89
22 0.87
23 0.88
24 0.86
25 0.85
26 0.81
27 0.76
28 0.68
29 0.69
30 0.63
31 0.53
32 0.44
33 0.37
34 0.31
35 0.27
36 0.25
37 0.15
38 0.12
39 0.12
40 0.14
41 0.15
42 0.14
43 0.15
44 0.15
45 0.16
46 0.15
47 0.17
48 0.16
49 0.14
50 0.14
51 0.11
52 0.1
53 0.1
54 0.1
55 0.08
56 0.08
57 0.07
58 0.06
59 0.06
60 0.07
61 0.06
62 0.1
63 0.08
64 0.09
65 0.09
66 0.1
67 0.09
68 0.09
69 0.09
70 0.06
71 0.06
72 0.05
73 0.05
74 0.05
75 0.06
76 0.06
77 0.06
78 0.06
79 0.06
80 0.07
81 0.06
82 0.06
83 0.08
84 0.09
85 0.13
86 0.14
87 0.18
88 0.19
89 0.25
90 0.26
91 0.26
92 0.33
93 0.3
94 0.3
95 0.28
96 0.26
97 0.22
98 0.22
99 0.21
100 0.14
101 0.12
102 0.12
103 0.1
104 0.09
105 0.08
106 0.07
107 0.06
108 0.05
109 0.06
110 0.06
111 0.06
112 0.06
113 0.06
114 0.06
115 0.07
116 0.08
117 0.08
118 0.08
119 0.09
120 0.09
121 0.09
122 0.1
123 0.08
124 0.1
125 0.15
126 0.16
127 0.2
128 0.23
129 0.23
130 0.23
131 0.24
132 0.23
133 0.2
134 0.2
135 0.17
136 0.17
137 0.17
138 0.17
139 0.15
140 0.14
141 0.16
142 0.16
143 0.16
144 0.15
145 0.22
146 0.22
147 0.24
148 0.24
149 0.2
150 0.21
151 0.19
152 0.19
153 0.13
154 0.13
155 0.11
156 0.11
157 0.13
158 0.13
159 0.16
160 0.17
161 0.2
162 0.2
163 0.19
164 0.19
165 0.17
166 0.15
167 0.11
168 0.09
169 0.06
170 0.05
171 0.05
172 0.07
173 0.07
174 0.09
175 0.09
176 0.11
177 0.12
178 0.14
179 0.2
180 0.24
181 0.33
182 0.37
183 0.42
184 0.41
185 0.42
186 0.5
187 0.52
188 0.52
189 0.46
190 0.48
191 0.54
192 0.6
193 0.6
194 0.53
195 0.47
196 0.44
197 0.42
198 0.37
199 0.32
200 0.28
201 0.29
202 0.33
203 0.3
204 0.29