Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9G2Q8

Protein Details
Accession A0A1B9G2Q8    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
21-49LTTPSTPKKAKPSPKKEKGSPNKPKQIKQHydrophilic
NLS Segment(s)
PositionSequence
27-46PKKAKPSPKKEKGSPNKPKQ
Subcellular Location(s) nucl 20, cyto_nucl 13.333, mito_nucl 10.999, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPAVKRESSSTPSLDSDLINLTTPSTPKKAKPSPKKEKGSPNKPKQIKQPWTEQEDTIFVELIEEVLKESLYAKVKVDGRLQRESPAVRAHLIALTGDELT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.23
3 0.19
4 0.18
5 0.16
6 0.14
7 0.12
8 0.12
9 0.13
10 0.14
11 0.16
12 0.19
13 0.22
14 0.26
15 0.36
16 0.44
17 0.53
18 0.62
19 0.7
20 0.76
21 0.83
22 0.86
23 0.84
24 0.86
25 0.86
26 0.86
27 0.86
28 0.84
29 0.84
30 0.82
31 0.79
32 0.78
33 0.78
34 0.74
35 0.67
36 0.67
37 0.62
38 0.62
39 0.59
40 0.49
41 0.39
42 0.32
43 0.3
44 0.2
45 0.15
46 0.09
47 0.07
48 0.07
49 0.06
50 0.05
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.05
57 0.1
58 0.13
59 0.14
60 0.15
61 0.21
62 0.24
63 0.28
64 0.35
65 0.37
66 0.39
67 0.45
68 0.45
69 0.42
70 0.44
71 0.42
72 0.38
73 0.36
74 0.33
75 0.27
76 0.27
77 0.25
78 0.21
79 0.2
80 0.16
81 0.12