Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7YT31

Protein Details
Accession C7YT31   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
26-53WTGVTSPAERRKRQNRIHKRAYRISHSTHydrophilic
NLS Segment(s)
PositionSequence
36-41RKRQNR
Subcellular Location(s) nucl 14, mito 7, cyto 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR021833  DUF3425  
KEGG nhe:NECHADRAFT_40803  -  
Pfam View protein in Pfam  
PF11905  DUF3425  
Amino Acid Sequences MNKPASTLVLESMPQQLRARHVGDDWTGVTSPAERRKRQNRIHKRAYRISHSTYTLFLYSPHSESVAHFVAAEKKRHELLGSQPSLSHPSVAPTGNSSEHIESQVPGQDYKHGAPRLDHLNIIVRVNVLAAFAHNATLLGFKFRGLCCSNLVLPFNQQQGPDLIETVTPSQGCPDWLHPTPLQMTVRHHPWIDLIPIPRLRDNILRTIQHGTHDNTPLAMDILDVRDMRSEAACLIVWGESWDPDGWEVAPLTMLTSSNLTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.28
4 0.31
5 0.36
6 0.37
7 0.31
8 0.31
9 0.31
10 0.3
11 0.3
12 0.25
13 0.22
14 0.2
15 0.19
16 0.18
17 0.17
18 0.22
19 0.29
20 0.37
21 0.4
22 0.5
23 0.61
24 0.71
25 0.78
26 0.82
27 0.84
28 0.86
29 0.92
30 0.9
31 0.88
32 0.87
33 0.84
34 0.81
35 0.75
36 0.71
37 0.65
38 0.6
39 0.52
40 0.44
41 0.39
42 0.31
43 0.25
44 0.2
45 0.2
46 0.19
47 0.19
48 0.18
49 0.17
50 0.17
51 0.17
52 0.22
53 0.18
54 0.15
55 0.14
56 0.14
57 0.22
58 0.27
59 0.3
60 0.26
61 0.27
62 0.28
63 0.29
64 0.28
65 0.22
66 0.26
67 0.32
68 0.32
69 0.3
70 0.29
71 0.3
72 0.33
73 0.3
74 0.23
75 0.13
76 0.14
77 0.16
78 0.16
79 0.15
80 0.12
81 0.15
82 0.14
83 0.16
84 0.16
85 0.15
86 0.15
87 0.16
88 0.15
89 0.13
90 0.13
91 0.15
92 0.13
93 0.13
94 0.12
95 0.14
96 0.15
97 0.17
98 0.22
99 0.2
100 0.2
101 0.21
102 0.24
103 0.26
104 0.25
105 0.23
106 0.17
107 0.21
108 0.21
109 0.21
110 0.17
111 0.12
112 0.11
113 0.11
114 0.1
115 0.05
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.05
125 0.05
126 0.06
127 0.06
128 0.07
129 0.1
130 0.1
131 0.15
132 0.15
133 0.16
134 0.16
135 0.18
136 0.19
137 0.19
138 0.2
139 0.15
140 0.17
141 0.19
142 0.2
143 0.19
144 0.18
145 0.16
146 0.16
147 0.17
148 0.15
149 0.12
150 0.09
151 0.08
152 0.09
153 0.09
154 0.1
155 0.08
156 0.08
157 0.09
158 0.09
159 0.1
160 0.11
161 0.14
162 0.18
163 0.2
164 0.24
165 0.23
166 0.25
167 0.25
168 0.28
169 0.27
170 0.24
171 0.28
172 0.29
173 0.33
174 0.33
175 0.32
176 0.26
177 0.26
178 0.26
179 0.24
180 0.22
181 0.2
182 0.24
183 0.27
184 0.28
185 0.28
186 0.27
187 0.27
188 0.3
189 0.31
190 0.33
191 0.35
192 0.34
193 0.35
194 0.39
195 0.37
196 0.34
197 0.36
198 0.31
199 0.32
200 0.34
201 0.32
202 0.27
203 0.26
204 0.23
205 0.19
206 0.15
207 0.09
208 0.07
209 0.09
210 0.11
211 0.11
212 0.11
213 0.13
214 0.13
215 0.14
216 0.13
217 0.12
218 0.1
219 0.12
220 0.11
221 0.09
222 0.1
223 0.09
224 0.08
225 0.09
226 0.1
227 0.08
228 0.11
229 0.11
230 0.11
231 0.12
232 0.13
233 0.11
234 0.12
235 0.12
236 0.1
237 0.1
238 0.09
239 0.1
240 0.1
241 0.1
242 0.1