Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9G9V4

Protein Details
Accession A0A1B9G9V4    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
36-73KEAPNKPKGKSKHSKKPKTKRWNKNRRGKKKDDTESHWBasic
NLS Segment(s)
PositionSequence
38-66APNKPKGKSKHSKKPKTKRWNKNRRGKKK
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MTPNSYPEDHNHESSDEQSPVVDPAHIPLPPDHSDKEAPNKPKGKSKHSKKPKTKRWNKNRRGKKKDDTESHWFHKDSGAIITVRSEDNVKFEISKDKLGNVSKTFGVIFNESYYYASSSEPIYLPYPADTLSLFSISSAYPTQHRSSRAWTRIVPNTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.25
4 0.21
5 0.19
6 0.18
7 0.18
8 0.17
9 0.14
10 0.09
11 0.11
12 0.14
13 0.14
14 0.15
15 0.14
16 0.19
17 0.22
18 0.26
19 0.25
20 0.25
21 0.29
22 0.31
23 0.39
24 0.41
25 0.43
26 0.49
27 0.54
28 0.53
29 0.58
30 0.61
31 0.62
32 0.65
33 0.7
34 0.73
35 0.77
36 0.85
37 0.88
38 0.93
39 0.93
40 0.94
41 0.94
42 0.94
43 0.94
44 0.95
45 0.94
46 0.94
47 0.94
48 0.94
49 0.92
50 0.9
51 0.88
52 0.87
53 0.86
54 0.83
55 0.78
56 0.75
57 0.72
58 0.66
59 0.6
60 0.5
61 0.41
62 0.35
63 0.29
64 0.21
65 0.16
66 0.14
67 0.1
68 0.1
69 0.1
70 0.09
71 0.08
72 0.08
73 0.09
74 0.07
75 0.09
76 0.1
77 0.1
78 0.1
79 0.11
80 0.18
81 0.18
82 0.22
83 0.21
84 0.21
85 0.26
86 0.28
87 0.31
88 0.26
89 0.26
90 0.22
91 0.22
92 0.21
93 0.17
94 0.17
95 0.14
96 0.13
97 0.12
98 0.13
99 0.13
100 0.13
101 0.12
102 0.11
103 0.11
104 0.1
105 0.1
106 0.1
107 0.11
108 0.11
109 0.12
110 0.12
111 0.12
112 0.12
113 0.12
114 0.12
115 0.11
116 0.12
117 0.1
118 0.1
119 0.11
120 0.11
121 0.1
122 0.09
123 0.1
124 0.09
125 0.12
126 0.11
127 0.11
128 0.14
129 0.19
130 0.24
131 0.28
132 0.33
133 0.33
134 0.41
135 0.5
136 0.53
137 0.54
138 0.54
139 0.57