Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B9FRB8

Protein Details
Accession A0A1B9FRB8    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGKRKAAKKPQAKKKAEPLSSVHydrophilic
150-171LDDGGRREKRRRVRDDYDDEDDAcidic
NLS Segment(s)
PositionSequence
3-16KRKAAKKPQAKKKA
Subcellular Location(s) mito 13.5, mito_nucl 12.666, nucl 10.5, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKAAKKPQAKKKAEPLSSVFKCLFCNHEKAVTVKIDKQSMFGHLTCKVCGQRFTSPINSLSVPVDVYCDWVDACEEVRAKQPPKQRPVRAPSPLAHGRGGGVSFDVDKPTQEVDEDAEGEEEEYDTRTKSTRREVDEDDVDEDEDDLDDGGRREKRRRVRDDYDDEDDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.87
3 0.8
4 0.75
5 0.69
6 0.69
7 0.62
8 0.58
9 0.49
10 0.39
11 0.37
12 0.34
13 0.35
14 0.28
15 0.31
16 0.29
17 0.32
18 0.33
19 0.32
20 0.35
21 0.35
22 0.34
23 0.34
24 0.36
25 0.36
26 0.34
27 0.35
28 0.31
29 0.3
30 0.3
31 0.26
32 0.24
33 0.24
34 0.26
35 0.23
36 0.26
37 0.26
38 0.25
39 0.28
40 0.3
41 0.3
42 0.33
43 0.37
44 0.37
45 0.35
46 0.34
47 0.33
48 0.28
49 0.24
50 0.2
51 0.16
52 0.12
53 0.1
54 0.1
55 0.08
56 0.1
57 0.09
58 0.08
59 0.08
60 0.08
61 0.08
62 0.06
63 0.07
64 0.08
65 0.08
66 0.09
67 0.13
68 0.18
69 0.19
70 0.23
71 0.31
72 0.36
73 0.45
74 0.53
75 0.55
76 0.59
77 0.64
78 0.67
79 0.64
80 0.59
81 0.52
82 0.5
83 0.48
84 0.42
85 0.35
86 0.27
87 0.23
88 0.2
89 0.19
90 0.11
91 0.08
92 0.06
93 0.06
94 0.07
95 0.08
96 0.07
97 0.07
98 0.09
99 0.09
100 0.09
101 0.08
102 0.08
103 0.09
104 0.1
105 0.1
106 0.09
107 0.09
108 0.08
109 0.08
110 0.08
111 0.06
112 0.05
113 0.06
114 0.06
115 0.07
116 0.08
117 0.11
118 0.13
119 0.19
120 0.28
121 0.35
122 0.4
123 0.46
124 0.5
125 0.54
126 0.56
127 0.52
128 0.44
129 0.38
130 0.32
131 0.26
132 0.21
133 0.14
134 0.1
135 0.08
136 0.06
137 0.05
138 0.07
139 0.07
140 0.14
141 0.19
142 0.25
143 0.32
144 0.42
145 0.52
146 0.61
147 0.7
148 0.74
149 0.77
150 0.83
151 0.84
152 0.82
153 0.79