Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B9FWW0

Protein Details
Accession A0A1B9FWW0    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
194-213EDRRRGGRSRKGKVGIRNGLBasic
NLS Segment(s)
PositionSequence
196-206RRRGGRSRKGK
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 4.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036249  Thioredoxin-like_sf  
CDD cd02989  Phd_like_TxnDC9  
Amino Acid Sequences MSAPPSPTLSDSELLDSLDEAGFDLASDRERRIEALQREIKQVRDLKESDNGRVITFNDEKSLIERMSKERYCLLHFFHNDFSRCKIMDQKLSDLAPSHPHTLFLRASVSDVPFLVTKMAVQVLPCVICFVDGRAVDRLIGFEELGDSDHFTSKVLEFRLKQSGVLPSDLSLASNLSSTLVPTRKDEDDQSDDEDRRRGGRSRKGKVGIRNGLFNGGDDDDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.15
4 0.13
5 0.11
6 0.1
7 0.07
8 0.07
9 0.06
10 0.06
11 0.07
12 0.06
13 0.1
14 0.11
15 0.12
16 0.14
17 0.15
18 0.17
19 0.21
20 0.29
21 0.3
22 0.38
23 0.45
24 0.45
25 0.52
26 0.52
27 0.5
28 0.48
29 0.5
30 0.44
31 0.43
32 0.42
33 0.37
34 0.43
35 0.44
36 0.39
37 0.39
38 0.36
39 0.3
40 0.3
41 0.27
42 0.26
43 0.26
44 0.23
45 0.19
46 0.19
47 0.19
48 0.19
49 0.22
50 0.15
51 0.16
52 0.18
53 0.2
54 0.29
55 0.29
56 0.29
57 0.3
58 0.32
59 0.33
60 0.34
61 0.33
62 0.32
63 0.33
64 0.34
65 0.35
66 0.38
67 0.36
68 0.35
69 0.35
70 0.3
71 0.28
72 0.27
73 0.29
74 0.28
75 0.33
76 0.34
77 0.34
78 0.34
79 0.33
80 0.33
81 0.26
82 0.22
83 0.21
84 0.21
85 0.21
86 0.17
87 0.19
88 0.19
89 0.21
90 0.21
91 0.16
92 0.15
93 0.12
94 0.13
95 0.12
96 0.12
97 0.09
98 0.09
99 0.09
100 0.08
101 0.08
102 0.07
103 0.06
104 0.05
105 0.05
106 0.06
107 0.05
108 0.05
109 0.06
110 0.06
111 0.07
112 0.07
113 0.06
114 0.06
115 0.06
116 0.06
117 0.06
118 0.1
119 0.1
120 0.12
121 0.13
122 0.14
123 0.13
124 0.13
125 0.13
126 0.09
127 0.09
128 0.07
129 0.06
130 0.06
131 0.06
132 0.07
133 0.07
134 0.06
135 0.07
136 0.08
137 0.08
138 0.08
139 0.1
140 0.1
141 0.13
142 0.15
143 0.19
144 0.19
145 0.23
146 0.3
147 0.29
148 0.28
149 0.27
150 0.32
151 0.29
152 0.29
153 0.25
154 0.18
155 0.2
156 0.19
157 0.17
158 0.11
159 0.09
160 0.08
161 0.08
162 0.07
163 0.07
164 0.07
165 0.07
166 0.13
167 0.16
168 0.18
169 0.2
170 0.25
171 0.27
172 0.3
173 0.32
174 0.33
175 0.35
176 0.36
177 0.39
178 0.4
179 0.39
180 0.39
181 0.39
182 0.33
183 0.3
184 0.32
185 0.35
186 0.38
187 0.47
188 0.55
189 0.61
190 0.69
191 0.74
192 0.77
193 0.79
194 0.8
195 0.8
196 0.72
197 0.69
198 0.61
199 0.57
200 0.5
201 0.42
202 0.34