Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7Z2G9

Protein Details
Accession C7Z2G9    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
71-103EAECHSQPKENRRKKRTRRQTPQAQPRTRRESSHydrophilic
NLS Segment(s)
PositionSequence
79-98KENRRKKRTRRQTPQAQPRT
Subcellular Location(s) nucl 19, cyto_nucl 13, mito 5
Family & Domain DBs
KEGG nhe:NECHADRAFT_87598  -  
Amino Acid Sequences MSSRIFGPKTVTFEISASEISCKSCIEDYLKTKVLQYRVTYVSKRNSWEIITTGDPEEIKAGVRPFMAEKEAECHSQPKENRRKKRTRRQTPQAQPRTRRESSPLPSPLPPPPPPTPQPPSKNPDVLAIH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.25
3 0.21
4 0.15
5 0.14
6 0.14
7 0.14
8 0.14
9 0.13
10 0.13
11 0.14
12 0.16
13 0.19
14 0.25
15 0.28
16 0.34
17 0.37
18 0.35
19 0.37
20 0.39
21 0.39
22 0.37
23 0.34
24 0.33
25 0.35
26 0.39
27 0.38
28 0.39
29 0.42
30 0.4
31 0.41
32 0.38
33 0.35
34 0.31
35 0.31
36 0.26
37 0.22
38 0.19
39 0.18
40 0.16
41 0.15
42 0.13
43 0.12
44 0.11
45 0.08
46 0.08
47 0.08
48 0.08
49 0.08
50 0.08
51 0.08
52 0.08
53 0.09
54 0.1
55 0.08
56 0.08
57 0.1
58 0.12
59 0.13
60 0.13
61 0.15
62 0.15
63 0.22
64 0.25
65 0.33
66 0.42
67 0.51
68 0.61
69 0.69
70 0.79
71 0.83
72 0.91
73 0.92
74 0.92
75 0.93
76 0.93
77 0.94
78 0.94
79 0.94
80 0.93
81 0.91
82 0.88
83 0.86
84 0.84
85 0.75
86 0.67
87 0.62
88 0.61
89 0.57
90 0.58
91 0.54
92 0.49
93 0.49
94 0.5
95 0.5
96 0.48
97 0.46
98 0.43
99 0.44
100 0.48
101 0.5
102 0.55
103 0.56
104 0.59
105 0.63
106 0.65
107 0.66
108 0.66
109 0.67
110 0.6