Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9FSK5

Protein Details
Accession A0A1B9FSK5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
267-293RNLHYICKKPWKVRPERNTPEERKRTGBasic
NLS Segment(s)
Subcellular Location(s) cyto 9, extr 5, cyto_nucl 5, mito 3, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002495  Glyco_trans_8  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0016020  C:membrane  
GO:0016757  F:glycosyltransferase activity  
Pfam View protein in Pfam  
PF01501  Glyco_transf_8  
Amino Acid Sequences MTGLSLNPLEYISHPAPKKCAWVVFLLSTPSYLPGILVLAYTLRKYHSKYPLIVAVNPSLPLDAIRALEGYGLEVRVVQPLIPRGEIHLIAERFVDTWTKAAVFGFDDYDRVCLIDGDMMLRQNMDELFNIPLKPDQVAATFACICNLDKSAWAPSEWTRENCGFTPSHGPSAIHSPIPAQPTGTHSLLNSGLVVLTPSSHLLQRIHSLVESTASADQARIKEWSFPDQDLFADIFRGRWISIPWIYNAIKTMRYWHGNFYTDEEVRNLHYICKKPWKVRPERNTPEERKRTGKVYRVDAGDYADVKDGDVGRDEGRADAVTHGWWWEEYEGTKEGMRRGGYTWDEYVEGLTDRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.33
3 0.38
4 0.39
5 0.44
6 0.41
7 0.43
8 0.37
9 0.39
10 0.4
11 0.38
12 0.38
13 0.34
14 0.29
15 0.25
16 0.23
17 0.19
18 0.16
19 0.13
20 0.11
21 0.08
22 0.09
23 0.08
24 0.08
25 0.06
26 0.08
27 0.09
28 0.1
29 0.1
30 0.13
31 0.17
32 0.21
33 0.3
34 0.38
35 0.43
36 0.45
37 0.49
38 0.54
39 0.53
40 0.51
41 0.45
42 0.38
43 0.33
44 0.31
45 0.26
46 0.18
47 0.15
48 0.13
49 0.11
50 0.1
51 0.09
52 0.09
53 0.09
54 0.09
55 0.1
56 0.09
57 0.09
58 0.09
59 0.08
60 0.08
61 0.08
62 0.08
63 0.1
64 0.1
65 0.09
66 0.11
67 0.15
68 0.17
69 0.18
70 0.17
71 0.18
72 0.21
73 0.21
74 0.2
75 0.22
76 0.21
77 0.2
78 0.2
79 0.18
80 0.15
81 0.15
82 0.15
83 0.09
84 0.09
85 0.1
86 0.1
87 0.1
88 0.09
89 0.1
90 0.09
91 0.1
92 0.11
93 0.1
94 0.1
95 0.1
96 0.11
97 0.1
98 0.09
99 0.08
100 0.06
101 0.06
102 0.07
103 0.07
104 0.07
105 0.08
106 0.09
107 0.08
108 0.08
109 0.08
110 0.07
111 0.08
112 0.07
113 0.07
114 0.08
115 0.1
116 0.12
117 0.12
118 0.11
119 0.12
120 0.12
121 0.12
122 0.11
123 0.1
124 0.09
125 0.12
126 0.11
127 0.13
128 0.13
129 0.12
130 0.12
131 0.12
132 0.11
133 0.1
134 0.12
135 0.09
136 0.09
137 0.11
138 0.13
139 0.13
140 0.12
141 0.13
142 0.14
143 0.21
144 0.22
145 0.22
146 0.23
147 0.24
148 0.26
149 0.25
150 0.25
151 0.18
152 0.17
153 0.23
154 0.21
155 0.21
156 0.2
157 0.19
158 0.17
159 0.23
160 0.22
161 0.15
162 0.14
163 0.13
164 0.16
165 0.17
166 0.16
167 0.12
168 0.11
169 0.15
170 0.19
171 0.18
172 0.15
173 0.14
174 0.16
175 0.15
176 0.15
177 0.11
178 0.06
179 0.06
180 0.05
181 0.05
182 0.03
183 0.03
184 0.04
185 0.05
186 0.06
187 0.06
188 0.09
189 0.09
190 0.11
191 0.13
192 0.14
193 0.13
194 0.13
195 0.13
196 0.11
197 0.11
198 0.1
199 0.08
200 0.08
201 0.08
202 0.08
203 0.08
204 0.1
205 0.1
206 0.11
207 0.11
208 0.12
209 0.16
210 0.17
211 0.23
212 0.23
213 0.23
214 0.23
215 0.22
216 0.21
217 0.19
218 0.17
219 0.11
220 0.11
221 0.1
222 0.09
223 0.09
224 0.1
225 0.08
226 0.09
227 0.1
228 0.13
229 0.17
230 0.18
231 0.18
232 0.24
233 0.24
234 0.23
235 0.25
236 0.22
237 0.2
238 0.19
239 0.24
240 0.23
241 0.29
242 0.29
243 0.32
244 0.35
245 0.36
246 0.37
247 0.36
248 0.36
249 0.31
250 0.31
251 0.26
252 0.22
253 0.21
254 0.23
255 0.19
256 0.19
257 0.24
258 0.28
259 0.34
260 0.44
261 0.49
262 0.54
263 0.62
264 0.67
265 0.72
266 0.79
267 0.82
268 0.82
269 0.84
270 0.84
271 0.87
272 0.85
273 0.85
274 0.83
275 0.78
276 0.74
277 0.69
278 0.68
279 0.66
280 0.65
281 0.61
282 0.59
283 0.59
284 0.55
285 0.53
286 0.46
287 0.41
288 0.36
289 0.3
290 0.24
291 0.2
292 0.18
293 0.16
294 0.18
295 0.16
296 0.14
297 0.15
298 0.16
299 0.14
300 0.16
301 0.16
302 0.14
303 0.14
304 0.14
305 0.13
306 0.12
307 0.13
308 0.12
309 0.12
310 0.12
311 0.11
312 0.11
313 0.12
314 0.11
315 0.13
316 0.13
317 0.17
318 0.18
319 0.18
320 0.21
321 0.21
322 0.23
323 0.27
324 0.27
325 0.25
326 0.25
327 0.32
328 0.33
329 0.34
330 0.33
331 0.29
332 0.29
333 0.27
334 0.25
335 0.19