Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9FYS3

Protein Details
Accession A0A1B9FYS3    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
22-48TTDTRRKCPISPPPPGRKKRPNHSLLLHydrophilic
NLS Segment(s)
PositionSequence
36-41PGRKKR
Subcellular Location(s) nucl 13, mito_nucl 11.999, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
Amino Acid Sequences MTKPQKANVRFHSPPQSQSHPTTDTRRKCPISPPPPGRKKRPNHSLLLLLPKQIEFEQRNMNKPLDHTKYWNDYYSSPSIGEDEKLPKPPSKIKLYSTKWKLENPNPKCKPPSSSVDGEQAFYGNPMMMGYGGGMGMGMYPGMGVGPMGMGYGMGGGMGMMGYGMPRYGGAGTLKITFPIKNSRLLSAITKSINDNISPSDHG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.62
3 0.61
4 0.57
5 0.59
6 0.57
7 0.51
8 0.53
9 0.56
10 0.59
11 0.59
12 0.61
13 0.66
14 0.64
15 0.62
16 0.67
17 0.68
18 0.67
19 0.69
20 0.72
21 0.74
22 0.81
23 0.85
24 0.86
25 0.85
26 0.86
27 0.86
28 0.86
29 0.81
30 0.77
31 0.73
32 0.69
33 0.63
34 0.63
35 0.53
36 0.44
37 0.38
38 0.32
39 0.29
40 0.23
41 0.27
42 0.19
43 0.22
44 0.31
45 0.33
46 0.39
47 0.4
48 0.41
49 0.34
50 0.36
51 0.41
52 0.37
53 0.36
54 0.34
55 0.37
56 0.42
57 0.43
58 0.42
59 0.35
60 0.3
61 0.33
62 0.31
63 0.26
64 0.2
65 0.18
66 0.17
67 0.15
68 0.15
69 0.13
70 0.15
71 0.16
72 0.21
73 0.22
74 0.23
75 0.26
76 0.33
77 0.37
78 0.4
79 0.42
80 0.41
81 0.5
82 0.53
83 0.59
84 0.58
85 0.57
86 0.52
87 0.54
88 0.56
89 0.54
90 0.59
91 0.56
92 0.62
93 0.59
94 0.6
95 0.58
96 0.53
97 0.49
98 0.43
99 0.43
100 0.37
101 0.37
102 0.35
103 0.38
104 0.37
105 0.33
106 0.28
107 0.22
108 0.17
109 0.14
110 0.11
111 0.05
112 0.04
113 0.04
114 0.04
115 0.04
116 0.04
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.02
124 0.02
125 0.02
126 0.02
127 0.02
128 0.02
129 0.02
130 0.02
131 0.02
132 0.02
133 0.02
134 0.02
135 0.02
136 0.02
137 0.02
138 0.02
139 0.02
140 0.02
141 0.02
142 0.02
143 0.02
144 0.02
145 0.02
146 0.02
147 0.02
148 0.02
149 0.02
150 0.02
151 0.03
152 0.03
153 0.03
154 0.04
155 0.05
156 0.07
157 0.08
158 0.1
159 0.12
160 0.14
161 0.14
162 0.16
163 0.17
164 0.16
165 0.18
166 0.27
167 0.27
168 0.33
169 0.35
170 0.35
171 0.36
172 0.37
173 0.39
174 0.32
175 0.36
176 0.3
177 0.29
178 0.29
179 0.32
180 0.31
181 0.27
182 0.25
183 0.22