Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B9GEQ3

Protein Details
Accession A0A1B9GEQ3    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-23DATAPPSKRHKAEPRPKSRLTAHydrophilic
NLS Segment(s)
PositionSequence
9-18KRHKAEPRPK
Subcellular Location(s) nucl 18, mito_nucl 13.333, cyto_nucl 10.333, mito 7.5
Family & Domain DBs
Amino Acid Sequences MDATAPPSKRHKAEPRPKSRLTASLVSGTRAEINGRHRISSSSSSSHEQPKVTSSIPLHTPPPAITLIKVIPPRDPSRTPTFEETNAEGKYAVYWMERAFRAKDTYNTLKRKTDVKVNELFREKAEEMSREKKGYEDQIAKSKMEMEEMKRCCKADKERLDRENTRLSEENRGLVGRNNILQAEKQKVEDEYKAHRYVANEDSKRARNRGEFKGKQGERDQSVRGIGGVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.84
4 0.84
5 0.8
6 0.73
7 0.69
8 0.65
9 0.59
10 0.51
11 0.5
12 0.47
13 0.42
14 0.38
15 0.31
16 0.26
17 0.21
18 0.2
19 0.17
20 0.21
21 0.29
22 0.3
23 0.3
24 0.29
25 0.31
26 0.34
27 0.36
28 0.35
29 0.3
30 0.32
31 0.34
32 0.38
33 0.43
34 0.41
35 0.36
36 0.33
37 0.32
38 0.32
39 0.29
40 0.3
41 0.24
42 0.24
43 0.27
44 0.28
45 0.26
46 0.24
47 0.24
48 0.2
49 0.21
50 0.19
51 0.16
52 0.14
53 0.16
54 0.16
55 0.19
56 0.22
57 0.2
58 0.21
59 0.26
60 0.29
61 0.33
62 0.34
63 0.35
64 0.4
65 0.43
66 0.43
67 0.43
68 0.42
69 0.38
70 0.39
71 0.36
72 0.32
73 0.29
74 0.25
75 0.2
76 0.17
77 0.15
78 0.12
79 0.1
80 0.06
81 0.07
82 0.07
83 0.1
84 0.11
85 0.13
86 0.14
87 0.16
88 0.18
89 0.19
90 0.21
91 0.25
92 0.32
93 0.39
94 0.43
95 0.44
96 0.44
97 0.44
98 0.47
99 0.41
100 0.41
101 0.36
102 0.36
103 0.4
104 0.4
105 0.43
106 0.41
107 0.4
108 0.31
109 0.33
110 0.28
111 0.24
112 0.23
113 0.21
114 0.23
115 0.28
116 0.3
117 0.26
118 0.25
119 0.23
120 0.24
121 0.26
122 0.28
123 0.28
124 0.28
125 0.36
126 0.38
127 0.36
128 0.33
129 0.32
130 0.25
131 0.24
132 0.24
133 0.21
134 0.28
135 0.31
136 0.35
137 0.34
138 0.35
139 0.32
140 0.37
141 0.42
142 0.44
143 0.51
144 0.56
145 0.64
146 0.69
147 0.75
148 0.7
149 0.66
150 0.64
151 0.54
152 0.5
153 0.46
154 0.43
155 0.43
156 0.41
157 0.38
158 0.3
159 0.3
160 0.25
161 0.24
162 0.25
163 0.19
164 0.19
165 0.19
166 0.18
167 0.19
168 0.21
169 0.22
170 0.25
171 0.25
172 0.24
173 0.25
174 0.27
175 0.3
176 0.31
177 0.31
178 0.32
179 0.38
180 0.39
181 0.38
182 0.37
183 0.35
184 0.37
185 0.41
186 0.43
187 0.38
188 0.41
189 0.47
190 0.53
191 0.57
192 0.55
193 0.54
194 0.53
195 0.59
196 0.65
197 0.69
198 0.66
199 0.68
200 0.75
201 0.7
202 0.68
203 0.67
204 0.65
205 0.6
206 0.6
207 0.54
208 0.47
209 0.47
210 0.4