Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9G9D1

Protein Details
Accession A0A1B9G9D1    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
27-56ISTPKTNTPTKNKNKSPSKKPKTNNSPTTSHydrophilic
NLS Segment(s)
PositionSequence
41-46KSPSKK
Subcellular Location(s) nucl 18.5, cyto_nucl 12.333, mito_nucl 11.666, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001005  SANT/Myb  
Pfam View protein in Pfam  
PF00249  Myb_DNA-binding  
PROSITE View protein in PROSITE  
PS50090  MYB_LIKE  
CDD cd00167  SANT  
Amino Acid Sequences MPVKREYSSESGESLSDIDKDIKPSLISTPKTNTPTKNKNKSPSKKPKTNNSPTTSNLGKKMGSWSGEELKLLYSIMCPKKTGINWSEVASQIEGRDTKACQNKWARMQSKIMQAIEDMGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.16
3 0.11
4 0.11
5 0.14
6 0.14
7 0.17
8 0.18
9 0.18
10 0.18
11 0.18
12 0.24
13 0.28
14 0.29
15 0.3
16 0.33
17 0.38
18 0.43
19 0.46
20 0.47
21 0.49
22 0.57
23 0.64
24 0.7
25 0.7
26 0.76
27 0.82
28 0.84
29 0.86
30 0.87
31 0.86
32 0.85
33 0.84
34 0.85
35 0.85
36 0.86
37 0.84
38 0.77
39 0.72
40 0.64
41 0.62
42 0.55
43 0.46
44 0.38
45 0.3
46 0.25
47 0.21
48 0.22
49 0.19
50 0.17
51 0.16
52 0.16
53 0.18
54 0.18
55 0.18
56 0.15
57 0.13
58 0.12
59 0.11
60 0.08
61 0.06
62 0.13
63 0.18
64 0.19
65 0.19
66 0.2
67 0.25
68 0.27
69 0.33
70 0.27
71 0.28
72 0.29
73 0.3
74 0.31
75 0.27
76 0.27
77 0.2
78 0.19
79 0.14
80 0.16
81 0.15
82 0.14
83 0.15
84 0.15
85 0.23
86 0.31
87 0.32
88 0.37
89 0.45
90 0.51
91 0.58
92 0.67
93 0.64
94 0.6
95 0.66
96 0.64
97 0.65
98 0.64
99 0.55
100 0.45
101 0.41