Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B9G6Y0

Protein Details
Accession A0A1B9G6Y0    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
3-32NKQSAPCSPKYPPKKPKKVKKKDFAILTQHHydrophilic
NLS Segment(s)
PositionSequence
14-24PPKKPKKVKKK
Subcellular Location(s) nucl 25
Family & Domain DBs
Amino Acid Sequences MGNKQSAPCSPKYPPKKPKKVKKKDFAILTQHRPPGYTNAGSDFRIETELHSDKIRRQLEEMDALRSAARARSEGEDLPSYEASRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.76
3 0.84
4 0.88
5 0.92
6 0.93
7 0.95
8 0.95
9 0.94
10 0.92
11 0.89
12 0.85
13 0.8
14 0.79
15 0.75
16 0.71
17 0.66
18 0.59
19 0.51
20 0.45
21 0.4
22 0.35
23 0.31
24 0.26
25 0.21
26 0.22
27 0.24
28 0.23
29 0.22
30 0.17
31 0.13
32 0.14
33 0.13
34 0.09
35 0.14
36 0.15
37 0.15
38 0.17
39 0.18
40 0.19
41 0.28
42 0.3
43 0.25
44 0.26
45 0.28
46 0.3
47 0.37
48 0.35
49 0.28
50 0.26
51 0.25
52 0.23
53 0.2
54 0.18
55 0.13
56 0.13
57 0.12
58 0.14
59 0.18
60 0.21
61 0.22
62 0.26
63 0.26
64 0.25
65 0.28
66 0.27