Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9G0Z2

Protein Details
Accession A0A1B9G0Z2    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
124-145IKEPPKLPSTPFPNRNKRRCTDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR045298  Complex1_LYR_LYRM7  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0034551  P:mitochondrial respiratory chain complex III assembly  
CDD cd20267  Complex1_LYR_LYRM7  
Amino Acid Sequences MSFPASLKPAARSAYRSMLRASRITFNGDPTRHVQMLSVLRQTFSSPSLTPPAPGSAELRSPDAEFKPIIEEQVNEEEVQKRIEEWKETAQFLRRNVVQGVQDEDGTWKLRVTDETELGDNATIKEPPKLPSTPFPNRNKRRCTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.4
3 0.39
4 0.38
5 0.4
6 0.41
7 0.4
8 0.38
9 0.35
10 0.34
11 0.39
12 0.36
13 0.38
14 0.42
15 0.39
16 0.38
17 0.36
18 0.4
19 0.34
20 0.33
21 0.26
22 0.25
23 0.3
24 0.3
25 0.32
26 0.26
27 0.26
28 0.26
29 0.27
30 0.22
31 0.17
32 0.17
33 0.12
34 0.15
35 0.19
36 0.18
37 0.18
38 0.18
39 0.18
40 0.16
41 0.16
42 0.16
43 0.13
44 0.15
45 0.15
46 0.15
47 0.14
48 0.14
49 0.16
50 0.15
51 0.15
52 0.12
53 0.11
54 0.13
55 0.12
56 0.13
57 0.11
58 0.11
59 0.11
60 0.14
61 0.14
62 0.11
63 0.12
64 0.13
65 0.13
66 0.13
67 0.11
68 0.09
69 0.13
70 0.15
71 0.16
72 0.17
73 0.24
74 0.26
75 0.27
76 0.29
77 0.31
78 0.32
79 0.31
80 0.34
81 0.28
82 0.27
83 0.27
84 0.28
85 0.24
86 0.22
87 0.24
88 0.2
89 0.19
90 0.17
91 0.17
92 0.16
93 0.16
94 0.15
95 0.11
96 0.11
97 0.12
98 0.14
99 0.17
100 0.2
101 0.2
102 0.22
103 0.23
104 0.22
105 0.21
106 0.2
107 0.16
108 0.13
109 0.13
110 0.12
111 0.12
112 0.17
113 0.19
114 0.21
115 0.26
116 0.28
117 0.31
118 0.38
119 0.46
120 0.52
121 0.6
122 0.67
123 0.73
124 0.81
125 0.86