Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9FZH2

Protein Details
Accession A0A1B9FZH2    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
123-142RTVVMDSSRSRRRRRRRVHPBasic
NLS Segment(s)
PositionSequence
131-142RSRRRRRRRVHP
Subcellular Location(s) nucl 9, mito 5, cyto 4, plas 3, cyto_pero 3, extr 2, pero 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MLLDAYLPFILLFIPLISAQPTPTRPPTQPLTSIMQSTTSPIIHPTEHINSPSDVRFQTHQTGNINRVETGAGIDDHLWMSGVLHTVEKAVQKQDEDSLLKPETSLPAGDKLEEGKKVFEGGRTVVMDSSRSRRRRRRRVHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.08
5 0.09
6 0.1
7 0.14
8 0.17
9 0.21
10 0.27
11 0.32
12 0.32
13 0.37
14 0.42
15 0.42
16 0.43
17 0.41
18 0.41
19 0.38
20 0.37
21 0.32
22 0.28
23 0.23
24 0.22
25 0.2
26 0.14
27 0.12
28 0.13
29 0.15
30 0.13
31 0.14
32 0.16
33 0.18
34 0.2
35 0.2
36 0.2
37 0.19
38 0.21
39 0.21
40 0.19
41 0.15
42 0.16
43 0.16
44 0.18
45 0.22
46 0.22
47 0.25
48 0.26
49 0.28
50 0.29
51 0.3
52 0.28
53 0.22
54 0.21
55 0.18
56 0.13
57 0.11
58 0.09
59 0.06
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.04
67 0.04
68 0.05
69 0.05
70 0.05
71 0.06
72 0.06
73 0.06
74 0.08
75 0.09
76 0.1
77 0.12
78 0.13
79 0.13
80 0.15
81 0.16
82 0.19
83 0.19
84 0.19
85 0.21
86 0.2
87 0.2
88 0.19
89 0.18
90 0.16
91 0.15
92 0.15
93 0.12
94 0.16
95 0.16
96 0.17
97 0.16
98 0.18
99 0.2
100 0.23
101 0.23
102 0.19
103 0.19
104 0.22
105 0.22
106 0.21
107 0.21
108 0.19
109 0.23
110 0.22
111 0.23
112 0.21
113 0.21
114 0.21
115 0.22
116 0.3
117 0.34
118 0.41
119 0.51
120 0.6
121 0.71
122 0.8