Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B9G3L3

Protein Details
Accession A0A1B9G3L3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
147-167ALIPNKRPKQLKKILDEHCKLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023476  Pep_tRNA_hydro_II_dom_sf  
IPR002833  PTH2  
IPR042237  PTRHD1  
Gene Ontology GO:0004045  F:aminoacyl-tRNA hydrolase activity  
Pfam View protein in Pfam  
PF01981  PTH2  
Amino Acid Sequences MLLQRATPLSQHFIRSRPLLPLPFAPPARAMSTPTAENDPPKPTGLVMQIIIRRDLLTVHKWPTGPLLAQSAHAATAVLHKYRDHPDVRKYLEGEDGRGWEGMRKVVLEVPDENSLQEVATKIDNLANPIPYHLWIEQPENSPTALALIPNKRPKQLKKILDEHCKLFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.4
3 0.39
4 0.38
5 0.41
6 0.38
7 0.38
8 0.39
9 0.38
10 0.41
11 0.4
12 0.35
13 0.31
14 0.31
15 0.31
16 0.28
17 0.26
18 0.23
19 0.25
20 0.25
21 0.25
22 0.26
23 0.24
24 0.27
25 0.27
26 0.26
27 0.25
28 0.25
29 0.23
30 0.19
31 0.21
32 0.2
33 0.19
34 0.16
35 0.19
36 0.2
37 0.21
38 0.21
39 0.18
40 0.15
41 0.14
42 0.14
43 0.14
44 0.16
45 0.19
46 0.22
47 0.24
48 0.24
49 0.24
50 0.24
51 0.22
52 0.18
53 0.15
54 0.15
55 0.13
56 0.14
57 0.14
58 0.12
59 0.1
60 0.09
61 0.08
62 0.05
63 0.09
64 0.1
65 0.1
66 0.11
67 0.11
68 0.15
69 0.18
70 0.23
71 0.23
72 0.25
73 0.3
74 0.36
75 0.38
76 0.37
77 0.35
78 0.3
79 0.34
80 0.3
81 0.27
82 0.21
83 0.2
84 0.18
85 0.17
86 0.16
87 0.12
88 0.12
89 0.11
90 0.1
91 0.09
92 0.1
93 0.11
94 0.13
95 0.12
96 0.13
97 0.14
98 0.16
99 0.16
100 0.15
101 0.14
102 0.13
103 0.1
104 0.1
105 0.08
106 0.07
107 0.07
108 0.08
109 0.08
110 0.1
111 0.11
112 0.14
113 0.16
114 0.16
115 0.16
116 0.17
117 0.18
118 0.16
119 0.19
120 0.16
121 0.18
122 0.18
123 0.22
124 0.24
125 0.27
126 0.28
127 0.25
128 0.25
129 0.21
130 0.18
131 0.17
132 0.13
133 0.11
134 0.16
135 0.21
136 0.3
137 0.4
138 0.43
139 0.48
140 0.56
141 0.63
142 0.67
143 0.72
144 0.72
145 0.72
146 0.79
147 0.82
148 0.83
149 0.8