Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9G1D7

Protein Details
Accession A0A1B9G1D7    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
77-96PFSKRYLKYLTKKHLKKNSFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 10.5, cyto_nucl 7.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002671  Ribosomal_L22e  
IPR038526  Ribosomal_L22e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01776  Ribosomal_L22e  
Amino Acid Sequences MQLPKAPAASKTAAAGKPLHKFYVDASVPVNDNVFDLAAFEKFLHDRIKVEGKAGQLGDKIQIAKEGNKLVLTSSIPFSKRYLKYLTKKHLKKNSFENFLRVVATSKDTYSLRYFKVDQDEVEDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.32
4 0.37
5 0.38
6 0.37
7 0.3
8 0.3
9 0.29
10 0.34
11 0.29
12 0.23
13 0.22
14 0.22
15 0.23
16 0.22
17 0.21
18 0.11
19 0.11
20 0.1
21 0.08
22 0.06
23 0.06
24 0.06
25 0.06
26 0.06
27 0.06
28 0.07
29 0.07
30 0.1
31 0.12
32 0.12
33 0.13
34 0.16
35 0.23
36 0.22
37 0.23
38 0.23
39 0.22
40 0.24
41 0.23
42 0.2
43 0.13
44 0.13
45 0.13
46 0.11
47 0.11
48 0.08
49 0.11
50 0.11
51 0.12
52 0.14
53 0.14
54 0.14
55 0.14
56 0.14
57 0.11
58 0.12
59 0.11
60 0.1
61 0.1
62 0.13
63 0.14
64 0.15
65 0.17
66 0.24
67 0.25
68 0.28
69 0.33
70 0.39
71 0.47
72 0.56
73 0.64
74 0.65
75 0.71
76 0.77
77 0.8
78 0.76
79 0.73
80 0.74
81 0.73
82 0.72
83 0.66
84 0.61
85 0.53
86 0.49
87 0.44
88 0.34
89 0.26
90 0.19
91 0.22
92 0.18
93 0.16
94 0.2
95 0.19
96 0.23
97 0.27
98 0.3
99 0.28
100 0.32
101 0.34
102 0.35
103 0.43
104 0.41
105 0.36
106 0.38