Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9G2Q3

Protein Details
Accession A0A1B9G2Q3    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
16-37NTASGSPKKSHRKEKQPWSEEEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001005  SANT/Myb  
PROSITE View protein in PROSITE  
PS50090  MYB_LIKE  
Amino Acid Sequences MPAKREYSSDSDDKPNTASGSPKKSHRKEKQPWSEEEETKFLLIIDDIVKTHLWHAVKEHPEIAIRKGGAVRSHWDAMLSPSCSFDDSNHHDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.35
3 0.3
4 0.26
5 0.29
6 0.29
7 0.35
8 0.38
9 0.46
10 0.54
11 0.61
12 0.71
13 0.73
14 0.78
15 0.8
16 0.87
17 0.89
18 0.84
19 0.8
20 0.77
21 0.73
22 0.65
23 0.58
24 0.49
25 0.38
26 0.32
27 0.28
28 0.19
29 0.12
30 0.09
31 0.07
32 0.05
33 0.05
34 0.05
35 0.06
36 0.06
37 0.06
38 0.07
39 0.1
40 0.1
41 0.1
42 0.13
43 0.19
44 0.22
45 0.23
46 0.23
47 0.2
48 0.24
49 0.25
50 0.24
51 0.21
52 0.19
53 0.19
54 0.2
55 0.22
56 0.21
57 0.22
58 0.24
59 0.24
60 0.26
61 0.24
62 0.23
63 0.21
64 0.23
65 0.26
66 0.25
67 0.2
68 0.2
69 0.21
70 0.22
71 0.22
72 0.19
73 0.23