Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9GCJ2

Protein Details
Accession A0A1B9GCJ2    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
104-129APSSFIRPPRPPKKFRGWGPKIQNGVHydrophilic
NLS Segment(s)
PositionSequence
111-122PPRPPKKFRGWG
Subcellular Location(s) mito 21, nucl 3.5, cyto_nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039603  Fyv4  
IPR019083  IGR_protein_motif  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF09597  IGR  
Amino Acid Sequences MFLPSLRASSSKLPSAILGRRMISSTPRVMEKAPLRASAETPNPQDLLTLIGRNADTKLEAFSESWEKLNELWMRTVKLYDVGLSVKERRYLLWAFSRYSQGSAPSSFIRPPRPPKKFRGWGPKIQNGVRVRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.35
3 0.37
4 0.34
5 0.33
6 0.3
7 0.3
8 0.31
9 0.3
10 0.27
11 0.27
12 0.26
13 0.25
14 0.26
15 0.27
16 0.26
17 0.33
18 0.33
19 0.36
20 0.35
21 0.35
22 0.35
23 0.35
24 0.36
25 0.34
26 0.35
27 0.31
28 0.3
29 0.29
30 0.27
31 0.26
32 0.24
33 0.18
34 0.16
35 0.13
36 0.11
37 0.09
38 0.1
39 0.11
40 0.11
41 0.11
42 0.08
43 0.08
44 0.07
45 0.08
46 0.07
47 0.08
48 0.08
49 0.09
50 0.12
51 0.12
52 0.13
53 0.12
54 0.12
55 0.11
56 0.17
57 0.17
58 0.15
59 0.17
60 0.18
61 0.19
62 0.19
63 0.19
64 0.13
65 0.13
66 0.12
67 0.1
68 0.1
69 0.09
70 0.1
71 0.12
72 0.15
73 0.14
74 0.17
75 0.17
76 0.16
77 0.2
78 0.2
79 0.22
80 0.28
81 0.29
82 0.28
83 0.3
84 0.34
85 0.3
86 0.3
87 0.27
88 0.22
89 0.22
90 0.21
91 0.22
92 0.2
93 0.22
94 0.24
95 0.27
96 0.32
97 0.37
98 0.47
99 0.56
100 0.63
101 0.68
102 0.72
103 0.79
104 0.81
105 0.82
106 0.83
107 0.8
108 0.8
109 0.83
110 0.83
111 0.79
112 0.72
113 0.7