Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7ZBL3

Protein Details
Accession C7ZBL3    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
16-43LQLPRHPGAKRFYRRRRNLRMFQRGLQQHydrophilic
NLS Segment(s)
PositionSequence
7-33KHSPRHREPLQLPRHPGAKRFYRRRRN
Subcellular Location(s) nucl 20, cyto_nucl 14.5, cyto 5
Family & Domain DBs
KEGG nhe:NECHADRAFT_88467  -  
Amino Acid Sequences MGSSRAKHSPRHREPLQLPRHPGAKRFYRRRRNLRMFQRGLQQDECVCHGSARREWEASDYGPIDQHGPLPASTREDDDALPFSRYEGPRCDNDAYDQDGYDDASGQGLASPSCADLELRIHRVEETSAILREQLASVNSKLSIIDSRLEMVPKLFSQEIERLLTGQNIWPLQGSQSQIVPLETGSDRTVDSAELIIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.79
3 0.78
4 0.75
5 0.71
6 0.66
7 0.7
8 0.62
9 0.6
10 0.58
11 0.58
12 0.61
13 0.66
14 0.72
15 0.76
16 0.85
17 0.9
18 0.93
19 0.93
20 0.92
21 0.92
22 0.92
23 0.87
24 0.8
25 0.79
26 0.72
27 0.66
28 0.57
29 0.48
30 0.39
31 0.35
32 0.33
33 0.26
34 0.22
35 0.18
36 0.2
37 0.23
38 0.24
39 0.28
40 0.28
41 0.27
42 0.27
43 0.29
44 0.28
45 0.24
46 0.23
47 0.18
48 0.16
49 0.16
50 0.16
51 0.13
52 0.11
53 0.11
54 0.1
55 0.1
56 0.1
57 0.13
58 0.13
59 0.15
60 0.16
61 0.16
62 0.16
63 0.16
64 0.16
65 0.14
66 0.16
67 0.14
68 0.14
69 0.12
70 0.12
71 0.17
72 0.18
73 0.19
74 0.2
75 0.22
76 0.23
77 0.27
78 0.27
79 0.22
80 0.23
81 0.23
82 0.22
83 0.2
84 0.17
85 0.14
86 0.13
87 0.12
88 0.1
89 0.08
90 0.04
91 0.04
92 0.04
93 0.03
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.05
101 0.05
102 0.04
103 0.05
104 0.09
105 0.12
106 0.14
107 0.14
108 0.15
109 0.15
110 0.15
111 0.15
112 0.12
113 0.12
114 0.12
115 0.12
116 0.11
117 0.11
118 0.11
119 0.11
120 0.1
121 0.09
122 0.08
123 0.1
124 0.1
125 0.11
126 0.11
127 0.11
128 0.11
129 0.11
130 0.12
131 0.11
132 0.12
133 0.11
134 0.13
135 0.15
136 0.15
137 0.14
138 0.13
139 0.14
140 0.12
141 0.16
142 0.14
143 0.14
144 0.17
145 0.21
146 0.23
147 0.23
148 0.23
149 0.2
150 0.2
151 0.21
152 0.18
153 0.16
154 0.18
155 0.15
156 0.16
157 0.15
158 0.15
159 0.16
160 0.19
161 0.19
162 0.16
163 0.17
164 0.18
165 0.19
166 0.18
167 0.17
168 0.13
169 0.14
170 0.13
171 0.15
172 0.14
173 0.14
174 0.14
175 0.14
176 0.15
177 0.11
178 0.12