Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7Z8Q1

Protein Details
Accession C7Z8Q1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
236-266RAGPRNGVNKSRRRRGKKPTKKADDTGPKPDBasic
NLS Segment(s)
PositionSequence
238-258GPRNGVNKSRRRRGKKPTKKA
Subcellular Location(s) extr 20, mito 5
Family & Domain DBs
KEGG nhe:NECHADRAFT_81546  -  
Amino Acid Sequences MVSSPVSLFLIRSLGAASPRSGLFDDPYDDILSHANKLPVPLSPSFLPSSSLIITNPVLVIFSTLLAALPPFSWKRSNNWAPAQSGPVGSGPSSPSASAAAASSPPSTAAAAPTLAAAAVPAPAPTPALTPAPAPVPAPAPAPAPAPAHVTAPAPAFPALAPALAPAPAAYAAGGYHRCPHCHRMGSHRPEECRSAPQNGNYMPSLYLSCLRAPCCPPPGTTIAQVASQMAPQSARAGPRNGVNKSRRRRGKKPTKKADDTGPKPDDKDPGAGSTGGGEVVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.16
4 0.15
5 0.17
6 0.17
7 0.19
8 0.19
9 0.18
10 0.18
11 0.19
12 0.21
13 0.2
14 0.21
15 0.2
16 0.19
17 0.18
18 0.19
19 0.18
20 0.17
21 0.18
22 0.19
23 0.19
24 0.2
25 0.2
26 0.19
27 0.23
28 0.21
29 0.23
30 0.22
31 0.24
32 0.25
33 0.24
34 0.24
35 0.2
36 0.22
37 0.18
38 0.19
39 0.15
40 0.16
41 0.16
42 0.14
43 0.13
44 0.1
45 0.09
46 0.08
47 0.09
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.05
54 0.06
55 0.05
56 0.05
57 0.09
58 0.1
59 0.13
60 0.19
61 0.2
62 0.26
63 0.36
64 0.43
65 0.46
66 0.52
67 0.53
68 0.5
69 0.5
70 0.47
71 0.37
72 0.31
73 0.24
74 0.17
75 0.14
76 0.12
77 0.11
78 0.1
79 0.11
80 0.11
81 0.1
82 0.1
83 0.1
84 0.1
85 0.09
86 0.08
87 0.07
88 0.07
89 0.08
90 0.08
91 0.07
92 0.07
93 0.07
94 0.08
95 0.07
96 0.07
97 0.07
98 0.07
99 0.07
100 0.06
101 0.05
102 0.05
103 0.04
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.04
111 0.04
112 0.05
113 0.06
114 0.07
115 0.07
116 0.08
117 0.08
118 0.09
119 0.09
120 0.1
121 0.09
122 0.08
123 0.09
124 0.09
125 0.1
126 0.1
127 0.1
128 0.1
129 0.11
130 0.12
131 0.12
132 0.12
133 0.14
134 0.13
135 0.13
136 0.13
137 0.13
138 0.12
139 0.12
140 0.11
141 0.1
142 0.09
143 0.09
144 0.07
145 0.09
146 0.07
147 0.07
148 0.06
149 0.05
150 0.06
151 0.05
152 0.06
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.04
159 0.04
160 0.06
161 0.07
162 0.07
163 0.14
164 0.15
165 0.18
166 0.22
167 0.27
168 0.31
169 0.37
170 0.38
171 0.42
172 0.51
173 0.56
174 0.6
175 0.6
176 0.56
177 0.53
178 0.56
179 0.48
180 0.45
181 0.41
182 0.4
183 0.39
184 0.39
185 0.42
186 0.38
187 0.39
188 0.31
189 0.29
190 0.22
191 0.2
192 0.18
193 0.13
194 0.15
195 0.14
196 0.16
197 0.18
198 0.19
199 0.23
200 0.26
201 0.29
202 0.32
203 0.32
204 0.31
205 0.32
206 0.36
207 0.34
208 0.33
209 0.31
210 0.26
211 0.25
212 0.24
213 0.21
214 0.17
215 0.15
216 0.13
217 0.1
218 0.1
219 0.09
220 0.13
221 0.14
222 0.18
223 0.21
224 0.24
225 0.25
226 0.32
227 0.39
228 0.41
229 0.48
230 0.52
231 0.58
232 0.65
233 0.74
234 0.78
235 0.79
236 0.85
237 0.87
238 0.89
239 0.91
240 0.92
241 0.93
242 0.93
243 0.91
244 0.86
245 0.86
246 0.85
247 0.8
248 0.79
249 0.73
250 0.65
251 0.6
252 0.59
253 0.54
254 0.46
255 0.45
256 0.37
257 0.34
258 0.33
259 0.3
260 0.27
261 0.22
262 0.19