Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9GTT2

Protein Details
Accession A0A1B9GTT2    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-48GKVKSQCPKVEKQEKKKQPKGRAKKRMQYNRRFVNVTHydrophilic
NLS Segment(s)
PositionSequence
20-38KVEKQEKKKQPKGRAKKRM
Subcellular Location(s) nucl 9.5cyto_nucl 9.5, mito 9, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQCPKVEKQEKKKQPKGRAKKRMQYNRRFVNVTVAPGGKRRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.43
3 0.48
4 0.49
5 0.51
6 0.59
7 0.62
8 0.68
9 0.71
10 0.73
11 0.76
12 0.81
13 0.86
14 0.87
15 0.86
16 0.86
17 0.87
18 0.88
19 0.88
20 0.89
21 0.88
22 0.87
23 0.89
24 0.9
25 0.89
26 0.88
27 0.87
28 0.85
29 0.81
30 0.75
31 0.65
32 0.63
33 0.55
34 0.48
35 0.42
36 0.35
37 0.31