Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B9GMV4

Protein Details
Accession A0A1B9GMV4    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
124-148SLPTPERKAPPPKVKKEKKPTAAAAHydrophilic
198-223EVKEGGKKREKKEKKEKTAKAQPAKEBasic
NLS Segment(s)
PositionSequence
130-143RKAPPPKVKKEKKP
200-220KEGGKKREKKEKKEKTAKAQP
Subcellular Location(s) cyto 20.5, cyto_nucl 13.833, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036282  Glutathione-S-Trfase_C_sf  
IPR012340  NA-bd_OB-fold  
IPR002547  tRNA-bd_dom  
Gene Ontology GO:0016874  F:ligase activity  
GO:0000049  F:tRNA binding  
Pfam View protein in Pfam  
PF01588  tRNA_bind  
PROSITE View protein in PROSITE  
PS50886  TRBD  
CDD cd02799  tRNA_bind_EMAP-II_like  
Amino Acid Sequences MSSNVAEFVAAAERADPSLIGASDKDKAEIAKIAGETEGYVKDLSALNEKLTPLTYLYSNYPSSADVSLYAHLHPSLISAPATQHPTQPSLLRYFLQIQSLDSVQAAQKSLPNSFPSLDIDLSSLPTPERKAPPPKVKKEKKPTAAAADAASGAAAAAGSAVESVTGAVSAAVGAVTGAAASAANVVKEAVVGSAPAEVKEGGKKREKKEKKEKTAKAQPAKEEPTGPLPSMIDMRVGKVLDVKRHPDADSLYVESIDVGEAEPRTVCSGLVKYMTEDEIRGATIIVICNLKPVTMRGVKSFAMLLCATAKDGKEGGGVQFVLPPAGSQPGERIYFEGEKYENAKPEPQLNPKKKVFETIQPGFITLDTLEAAWIDPETKSVHKIRTKDGVCKAKSFVGASLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.08
5 0.11
6 0.11
7 0.12
8 0.12
9 0.14
10 0.19
11 0.2
12 0.19
13 0.18
14 0.18
15 0.2
16 0.23
17 0.21
18 0.21
19 0.2
20 0.2
21 0.19
22 0.18
23 0.16
24 0.15
25 0.14
26 0.11
27 0.11
28 0.1
29 0.12
30 0.14
31 0.15
32 0.19
33 0.2
34 0.2
35 0.23
36 0.23
37 0.22
38 0.21
39 0.2
40 0.14
41 0.16
42 0.15
43 0.15
44 0.18
45 0.22
46 0.21
47 0.21
48 0.21
49 0.19
50 0.21
51 0.19
52 0.16
53 0.13
54 0.14
55 0.15
56 0.15
57 0.15
58 0.13
59 0.12
60 0.12
61 0.11
62 0.11
63 0.1
64 0.1
65 0.1
66 0.1
67 0.12
68 0.16
69 0.22
70 0.21
71 0.24
72 0.25
73 0.27
74 0.29
75 0.3
76 0.29
77 0.28
78 0.29
79 0.26
80 0.26
81 0.28
82 0.28
83 0.28
84 0.25
85 0.22
86 0.22
87 0.22
88 0.19
89 0.14
90 0.14
91 0.11
92 0.12
93 0.12
94 0.11
95 0.13
96 0.15
97 0.17
98 0.18
99 0.19
100 0.19
101 0.19
102 0.2
103 0.2
104 0.2
105 0.19
106 0.16
107 0.15
108 0.13
109 0.14
110 0.13
111 0.11
112 0.08
113 0.1
114 0.12
115 0.17
116 0.22
117 0.28
118 0.38
119 0.47
120 0.58
121 0.66
122 0.75
123 0.8
124 0.85
125 0.88
126 0.9
127 0.9
128 0.87
129 0.84
130 0.78
131 0.73
132 0.65
133 0.55
134 0.45
135 0.35
136 0.27
137 0.19
138 0.14
139 0.07
140 0.05
141 0.04
142 0.03
143 0.02
144 0.02
145 0.02
146 0.02
147 0.02
148 0.02
149 0.02
150 0.02
151 0.02
152 0.02
153 0.02
154 0.02
155 0.02
156 0.02
157 0.02
158 0.02
159 0.02
160 0.02
161 0.02
162 0.02
163 0.02
164 0.02
165 0.02
166 0.02
167 0.02
168 0.02
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.04
175 0.04
176 0.05
177 0.03
178 0.03
179 0.03
180 0.03
181 0.06
182 0.06
183 0.06
184 0.06
185 0.07
186 0.07
187 0.13
188 0.16
189 0.19
190 0.27
191 0.34
192 0.39
193 0.5
194 0.59
195 0.64
196 0.72
197 0.78
198 0.81
199 0.85
200 0.86
201 0.85
202 0.87
203 0.85
204 0.82
205 0.75
206 0.68
207 0.64
208 0.62
209 0.53
210 0.44
211 0.36
212 0.33
213 0.3
214 0.26
215 0.2
216 0.16
217 0.15
218 0.15
219 0.14
220 0.12
221 0.11
222 0.11
223 0.13
224 0.13
225 0.12
226 0.16
227 0.19
228 0.21
229 0.25
230 0.27
231 0.28
232 0.3
233 0.31
234 0.28
235 0.27
236 0.24
237 0.23
238 0.21
239 0.18
240 0.16
241 0.15
242 0.12
243 0.11
244 0.07
245 0.05
246 0.04
247 0.05
248 0.05
249 0.06
250 0.06
251 0.06
252 0.08
253 0.08
254 0.08
255 0.09
256 0.1
257 0.11
258 0.13
259 0.13
260 0.13
261 0.14
262 0.15
263 0.13
264 0.12
265 0.11
266 0.1
267 0.1
268 0.09
269 0.08
270 0.07
271 0.08
272 0.08
273 0.08
274 0.09
275 0.09
276 0.11
277 0.11
278 0.11
279 0.11
280 0.12
281 0.18
282 0.22
283 0.24
284 0.24
285 0.28
286 0.28
287 0.28
288 0.29
289 0.21
290 0.19
291 0.17
292 0.15
293 0.13
294 0.13
295 0.13
296 0.14
297 0.14
298 0.13
299 0.13
300 0.13
301 0.13
302 0.14
303 0.14
304 0.14
305 0.14
306 0.12
307 0.14
308 0.13
309 0.12
310 0.11
311 0.1
312 0.08
313 0.12
314 0.12
315 0.1
316 0.13
317 0.18
318 0.2
319 0.2
320 0.2
321 0.21
322 0.24
323 0.24
324 0.25
325 0.21
326 0.22
327 0.26
328 0.29
329 0.29
330 0.28
331 0.32
332 0.31
333 0.38
334 0.43
335 0.49
336 0.56
337 0.6
338 0.67
339 0.68
340 0.74
341 0.67
342 0.68
343 0.62
344 0.6
345 0.62
346 0.57
347 0.58
348 0.5
349 0.5
350 0.42
351 0.37
352 0.29
353 0.19
354 0.15
355 0.09
356 0.09
357 0.08
358 0.08
359 0.08
360 0.07
361 0.07
362 0.07
363 0.07
364 0.09
365 0.12
366 0.14
367 0.21
368 0.26
369 0.35
370 0.41
371 0.46
372 0.51
373 0.58
374 0.6
375 0.64
376 0.68
377 0.69
378 0.65
379 0.64
380 0.61
381 0.56
382 0.55
383 0.47